BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30721 (719 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCP25A2.02c |rhp26||SNF2 family helicase Rhp26|Schizosaccharomy... 29 0.88 SPBPB2B2.17c |||dubious|Schizosaccharomyces pombe|chr 2|||Manual 28 1.5 SPBC21D10.11c |nfs1||iron-sulfur cluster assembly protein Nfs1|S... 28 1.5 SPAC977.02 |||S. pombe specific 5Tm protein family|Schizosacchar... 28 1.5 SPBC1348.03 |||dubious|Schizosaccharomyces pombe|chr 2|||Manual 28 1.5 SPAC750.04c |||dubious|Schizosaccharomyces pombe|chr 1|||Manual 28 1.5 SPBC17D1.07c |||GTPase regulator |Schizosaccharomyces pombe|chr ... 27 3.6 SPAC1A6.09c |lag1||sphingosine N-acyltransferase Lag1|Schizosacc... 26 4.7 >SPCP25A2.02c |rhp26||SNF2 family helicase Rhp26|Schizosaccharomyces pombe|chr 3|||Manual Length = 973 Score = 28.7 bits (61), Expect = 0.88 Identities = 9/20 (45%), Positives = 15/20 (75%) Frame = +2 Query: 32 PPRHVASPQETLSIPSTSRP 91 PPR + PQ++ ++P TS+P Sbjct: 937 PPRQLIPPQQSTNVPGTSKP 956 >SPBPB2B2.17c |||dubious|Schizosaccharomyces pombe|chr 2|||Manual Length = 146 Score = 27.9 bits (59), Expect = 1.5 Identities = 11/28 (39%), Positives = 20/28 (71%), Gaps = 1/28 (3%) Frame = +1 Query: 271 NKFY-RFMKSHLLNLVKVFFKCLIRVLF 351 NKF+ RF+++H +N ++ F K + +LF Sbjct: 82 NKFFPRFIRTHSINSIRTFSKFQVIILF 109 >SPBC21D10.11c |nfs1||iron-sulfur cluster assembly protein Nfs1|Schizosaccharomyces pombe|chr 2|||Manual Length = 498 Score = 27.9 bits (59), Expect = 1.5 Identities = 15/44 (34%), Positives = 23/44 (52%) Frame = +1 Query: 208 PREISSQQFICISNNL*ISNTNKFYRFMKSHLLNLVKVFFKCLI 339 PREI SNN + +FY+ K HL++ V+ KC++ Sbjct: 160 PREIIFTSGATESNNAILKGVARFYKSRKKHLVS-VQTEHKCVL 202 >SPAC977.02 |||S. pombe specific 5Tm protein family|Schizosaccharomyces pombe|chr 1|||Manual Length = 146 Score = 27.9 bits (59), Expect = 1.5 Identities = 11/28 (39%), Positives = 20/28 (71%), Gaps = 1/28 (3%) Frame = +1 Query: 271 NKFY-RFMKSHLLNLVKVFFKCLIRVLF 351 NKF+ RF+++H +N ++ F K + +LF Sbjct: 82 NKFFPRFIRTHSINSIRTFSKFQVIILF 109 >SPBC1348.03 |||dubious|Schizosaccharomyces pombe|chr 2|||Manual Length = 146 Score = 27.9 bits (59), Expect = 1.5 Identities = 11/28 (39%), Positives = 20/28 (71%), Gaps = 1/28 (3%) Frame = +1 Query: 271 NKFY-RFMKSHLLNLVKVFFKCLIRVLF 351 NKF+ RF+++H +N ++ F K + +LF Sbjct: 82 NKFFPRFIRTHSINSIRTFSKFQVIILF 109 >SPAC750.04c |||dubious|Schizosaccharomyces pombe|chr 1|||Manual Length = 146 Score = 27.9 bits (59), Expect = 1.5 Identities = 11/28 (39%), Positives = 20/28 (71%), Gaps = 1/28 (3%) Frame = +1 Query: 271 NKFY-RFMKSHLLNLVKVFFKCLIRVLF 351 NKF+ RF+++H +N ++ F K + +LF Sbjct: 82 NKFFPRFIRTHSINSIRTFSKFQVIILF 109 >SPBC17D1.07c |||GTPase regulator |Schizosaccharomyces pombe|chr 2|||Manual Length = 962 Score = 26.6 bits (56), Expect = 3.6 Identities = 15/39 (38%), Positives = 20/39 (51%) Frame = -1 Query: 650 ITSRQLIDDISKLDILQYTPLINKLFKLRHNAIQARSFI 534 I SR D I K+D+ + LI K F +A RSF+ Sbjct: 364 IISRFSSDGIDKIDVQNFILLILKFFGFAISASDRRSFL 402 >SPAC1A6.09c |lag1||sphingosine N-acyltransferase Lag1|Schizosaccharomyces pombe|chr 1|||Manual Length = 390 Score = 26.2 bits (55), Expect = 4.7 Identities = 11/24 (45%), Positives = 16/24 (66%) Frame = -1 Query: 482 YIYISQIYCKFIRVVFTNDIIIYI 411 YI+ IY FI ++FT ++IYI Sbjct: 328 YIFNKPIYIAFIILLFTLQLLIYI 351 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,882,687 Number of Sequences: 5004 Number of extensions: 56823 Number of successful extensions: 129 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 128 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 129 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 337208592 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -