BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30719 (730 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY500239-1|AAR92109.1| 555|Apis mellifera neuronal nicotinic ac... 25 0.73 DQ325115-1|ABD14129.1| 185|Apis mellifera complementary sex det... 23 2.2 DQ435329-1|ABD92644.1| 150|Apis mellifera OBP12 protein. 22 6.8 DQ244074-1|ABB36784.1| 517|Apis mellifera cytochrome P450 monoo... 21 9.0 >AY500239-1|AAR92109.1| 555|Apis mellifera neuronal nicotinic acetylcholine receptoralpha7-1 protein. Length = 555 Score = 25.0 bits (52), Expect = 0.73 Identities = 11/26 (42%), Positives = 16/26 (61%) Frame = -1 Query: 148 ILLNCCFCKKKQGN*KLKYVAILTNQ 71 IL N CFC + + LK + I+T+Q Sbjct: 480 ILQNACFCARNELMMILKEIKIITDQ 505 >DQ325115-1|ABD14129.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 23.4 bits (48), Expect = 2.2 Identities = 13/34 (38%), Positives = 19/34 (55%), Gaps = 3/34 (8%) Frame = -1 Query: 706 NSISNT---NEQLMIYSFHTSTEITRV*YYNIIN 614 NS+SN N Y+ + +T ++ YYNIIN Sbjct: 86 NSLSNNYNYNNNYNNYNNNYNTNYKKLQYYNIIN 119 >DQ435329-1|ABD92644.1| 150|Apis mellifera OBP12 protein. Length = 150 Score = 21.8 bits (44), Expect = 6.8 Identities = 8/13 (61%), Positives = 10/13 (76%) Frame = -2 Query: 75 IKTFISKIELTCK 37 +KTF KI LTC+ Sbjct: 106 LKTFFHKIALTCE 118 >DQ244074-1|ABB36784.1| 517|Apis mellifera cytochrome P450 monooxygenase protein. Length = 517 Score = 21.4 bits (43), Expect = 9.0 Identities = 14/48 (29%), Positives = 18/48 (37%) Frame = -2 Query: 333 NYEKNQQFSVKQYCKVAHNCKNYILRPPNRKCIIYRKRNPDI*NILGL 190 N+ FS + + Y LRPP YR+ D LGL Sbjct: 101 NFPMISVFSRQDIETIIRRNSRYPLRPPQEVISHYRRTRRDRYTNLGL 148 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 192,421 Number of Sequences: 438 Number of extensions: 3990 Number of successful extensions: 14 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 14 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 22657590 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -