BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30718 (618 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF016415-8|AAW88415.1| 297|Caenorhabditis elegans Serpentine re... 29 3.5 AL132876-3|CAD21657.2| 746|Caenorhabditis elegans Hypothetical ... 28 6.1 >AF016415-8|AAW88415.1| 297|Caenorhabditis elegans Serpentine receptor, class bc (class b-like) protein 32 protein. Length = 297 Score = 28.7 bits (61), Expect = 3.5 Identities = 14/29 (48%), Positives = 17/29 (58%) Frame = +2 Query: 224 FXIAVAQCPKNYTXAHRSITFTIALXXNI 310 F AV QC N+ AHR+I F I L +I Sbjct: 161 FGCAVNQCFYNFWTAHRTIIFAIILVSSI 189 >AL132876-3|CAD21657.2| 746|Caenorhabditis elegans Hypothetical protein Y105E8A.3 protein. Length = 746 Score = 27.9 bits (59), Expect = 6.1 Identities = 13/44 (29%), Positives = 23/44 (52%) Frame = -3 Query: 259 IIFWALSNSNXKVYNFMIHKASPI*VSKFIFKNYFSFNSICXVH 128 ++ WALS+S+ + + A + ++ F+F F SIC H Sbjct: 247 VLSWALSSSSGASIGYFHYAALLVIIAVFVFVLDFYAESICFQH 290 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,392,900 Number of Sequences: 27780 Number of extensions: 166133 Number of successful extensions: 252 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 252 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 252 length of database: 12,740,198 effective HSP length: 78 effective length of database: 10,573,358 effective search space used: 1342816466 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -