BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30713 (517 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_15460| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.046 SB_48999| Best HMM Match : 7tm_1 (HMM E-Value=2.3e-08) 33 0.11 SB_39389| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_30424| Best HMM Match : Chorion_3 (HMM E-Value=5.6) 32 0.32 SB_15139| Best HMM Match : Collagen (HMM E-Value=0.27) 31 0.43 SB_430| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.74 SB_12670| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.74 SB_3122| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.74 SB_12656| Best HMM Match : CS (HMM E-Value=0.0018) 30 1.3 SB_18760| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.7 SB_15652| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.7 SB_26370| Best HMM Match : Drf_FH1 (HMM E-Value=5.2) 29 2.3 SB_34695| Best HMM Match : CXC (HMM E-Value=4.7) 29 2.3 SB_58586| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.0 SB_50198| Best HMM Match : Frizzled (HMM E-Value=0) 29 3.0 SB_6516| Best HMM Match : DUF708 (HMM E-Value=8.5) 29 3.0 SB_58063| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.0 SB_51829| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.0 SB_48709| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.0 SB_42166| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.0 SB_25723| Best HMM Match : Vicilin_N (HMM E-Value=0.0045) 28 4.0 SB_25350| Best HMM Match : Collagen (HMM E-Value=0) 28 4.0 SB_21874| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.0 SB_12635| Best HMM Match : Chlam_PMP (HMM E-Value=0.018) 28 4.0 SB_40573| Best HMM Match : RRM_1 (HMM E-Value=1.8e-39) 28 4.0 SB_32181| Best HMM Match : CUB (HMM E-Value=0) 28 4.0 SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69) 28 5.3 SB_13377| Best HMM Match : Extensin_2 (HMM E-Value=0.00046) 28 5.3 SB_43407| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.3 SB_48061| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.9 SB_45789| Best HMM Match : E-MAP-115 (HMM E-Value=1.8) 27 6.9 SB_33219| Best HMM Match : RhoGAP (HMM E-Value=0.0014) 27 6.9 SB_23536| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.9 SB_20893| Best HMM Match : 7tm_1 (HMM E-Value=1.5e-23) 27 6.9 SB_58392| Best HMM Match : Peptidase_M16_C (HMM E-Value=1.2e-24) 27 6.9 SB_21796| Best HMM Match : COLFI (HMM E-Value=0) 27 6.9 SB_3045| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.9 SB_51860| Best HMM Match : ShTK (HMM E-Value=1.5e-09) 27 9.2 SB_46164| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2 SB_36280| Best HMM Match : Dehydrin (HMM E-Value=4.4) 27 9.2 SB_26920| Best HMM Match : Rap_GAP (HMM E-Value=6.9e-29) 27 9.2 SB_43036| Best HMM Match : Chorion_3 (HMM E-Value=1.6) 27 9.2 SB_32600| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2 SB_17926| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.2 SB_9876| Best HMM Match : TSNR_N (HMM E-Value=7.6) 27 9.2 >SB_15460| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 419 Score = 34.7 bits (76), Expect = 0.046 Identities = 26/77 (33%), Positives = 34/77 (44%) Frame = +3 Query: 132 PAPYLGPGRSPVGAIETAGQG*RRAHYIHPTVPRTPDRWPPATRPPVPSFSGPRARFDGA 311 P P LGPG P G++ A H++ PT+PR P + A RP +P G F G Sbjct: 234 PHP-LGPGDRPYGSVPMAAASMDARHFV-PTMPREP-FFMEAQRPQLPPVGG----FPGQ 286 Query: 312 ALHLSPERSGERGLPSP 362 A + G P P Sbjct: 287 APPHMSTHVPQAGFPHP 303 >SB_48999| Best HMM Match : 7tm_1 (HMM E-Value=2.3e-08) Length = 1158 Score = 33.5 bits (73), Expect = 0.11 Identities = 23/72 (31%), Positives = 32/72 (44%) Frame = +3 Query: 216 HPTVPRTPDRWPPATRPPVPSFSGPRARFDGAALHLSPERSGERGLPSPGFLLRVSVQST 395 H P T AT P +P+ P ALH+SPE G++G +P + + Sbjct: 704 HTFYPYTNKTATTATTPDLPT---PYLATAAPALHVSPEEPGKQGPSTP----EAMILQS 756 Query: 396 PPHVWVSPRTKR 431 PP+ PRT R Sbjct: 757 PPNAVERPRTIR 768 >SB_39389| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 33.1 bits (72), Expect = 0.14 Identities = 16/41 (39%), Positives = 18/41 (43%) Frame = +3 Query: 228 PRTPDRWPPATRPPVPSFSGPRARFDGAALHLSPERSGERG 350 P+T RW P PP P FS P R G S E + G Sbjct: 120 PQTTGRWGPTPPPPNPKFSIPFIRGGGGGYRYSLELHNDNG 160 >SB_30424| Best HMM Match : Chorion_3 (HMM E-Value=5.6) Length = 377 Score = 31.9 bits (69), Expect = 0.32 Identities = 19/62 (30%), Positives = 23/62 (37%) Frame = +3 Query: 162 PVGAIETAGQG*RRAHYIHPTVPRTPDRWPPATRPPVPSFSGPRARFDGAALHLSPERSG 341 PVGA AG R H P + R P RW P + A H + SG Sbjct: 293 PVGAHNMAGGHPRVQHVTDPGIDRVPSRWQSKDSAPAKVHAEGAAPTPSPRTHAAHSISG 352 Query: 342 ER 347 E+ Sbjct: 353 EK 354 >SB_15139| Best HMM Match : Collagen (HMM E-Value=0.27) Length = 562 Score = 31.5 bits (68), Expect = 0.43 Identities = 18/51 (35%), Positives = 23/51 (45%) Frame = -1 Query: 373 NRKPGDGRPRSPDRSGERCNAAPSKRALGPLNEGTGGRVAGGHRSGVRGTV 221 NR R+ +R+ R N + RA N +GGRVA G R G V Sbjct: 191 NRANNRANNRANNRANNRANNRANNRANNRANNPSGGRVASGWRVASGGRV 241 >SB_430| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2202 Score = 30.7 bits (66), Expect = 0.74 Identities = 19/50 (38%), Positives = 24/50 (48%) Frame = +2 Query: 128 TTGALPRTGPEPSRGY*NGGTGLTQSTLHPSHRPTDAGPVAASDTTTGSL 277 TTG L TG + G N G+G T S ++ T G S TTTG + Sbjct: 580 TTGGL-NTGSGTTTGGVNSGSGTTTSGVNTGSGTTTGGVNTGSGTTTGEV 628 Score = 27.5 bits (58), Expect = 6.9 Identities = 17/50 (34%), Positives = 24/50 (48%) Frame = +2 Query: 128 TTGALPRTGPEPSRGY*NGGTGLTQSTLHPSHRPTDAGPVAASDTTTGSL 277 TTG + TG + G N G+G T ++ T +G S TTTG + Sbjct: 569 TTGGV-NTGSGTTTGGLNTGSGTTTGGVNSGSGTTTSGVNTGSGTTTGGV 617 >SB_12670| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1272 Score = 30.7 bits (66), Expect = 0.74 Identities = 37/126 (29%), Positives = 49/126 (38%), Gaps = 2/126 (1%) Frame = +3 Query: 48 RRKSPDPHPRGRWGMWELNLTKNSCRSQPAPYLGPGRSPVGAIETAGQG*RRAHYIHPTV 227 RR+S D PR R + + RS+ +P RSP RR + + Sbjct: 825 RRRSRDASPRRRRRSASGSDSSPHRRSE-SPRDRRRRSPEHRRRREASPPRRDRKRYDSP 883 Query: 228 PRTPDRWP--PATRPPVPSFSGPRARFDGAALHLSPERSGERGLPSPGFLLRVSVQSTPP 401 PR R P P R S+S R R D P R + PSP R S ++PP Sbjct: 884 PRRRRRSPSPPPRRRRRDSYSPSRRRRDSPTPSPPPRRRRKSPSPSPPRRRRRSPSNSPP 943 Query: 402 HVWVSP 419 + SP Sbjct: 944 PMRSSP 949 >SB_3122| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1246 Score = 30.7 bits (66), Expect = 0.74 Identities = 17/47 (36%), Positives = 22/47 (46%), Gaps = 1/47 (2%) Frame = +3 Query: 138 PY-LGPGRSPVGAIETAGQG*RRAHYIHPTVPRTPDRWPPATRPPVP 275 PY +G G+ + TA R HY P V TP W P++ P P Sbjct: 841 PYGIGLGQPMTAPLTTADMNRRYPHY-QPQVFTTPPMWAPSSLNPTP 886 >SB_12656| Best HMM Match : CS (HMM E-Value=0.0018) Length = 277 Score = 29.9 bits (64), Expect = 1.3 Identities = 18/69 (26%), Positives = 26/69 (37%) Frame = +3 Query: 204 AHYIHPTVPRTPDRWPPATRPPVPSFSGPRARFDGAALHLSPERSGERGLPSPGFLLRVS 383 + YIHP P P P + PP P R+ + + R+ RG+P P + V Sbjct: 192 SRYIHPPFPLHPSPLPATSIPPSRYIHPPPFRY----IQVDEPRTLSRGIPLPDTVATVV 247 Query: 384 VQSTPPHVW 410 W Sbjct: 248 NMGREKFTW 256 >SB_18760| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1569 Score = 29.5 bits (63), Expect = 1.7 Identities = 12/40 (30%), Positives = 22/40 (55%) Frame = +2 Query: 251 ASDTTTGSLVQRAESPL*WRRVTPFPRAVRGTRSTITRLP 370 A+DT T ++V+ +S P PR++RG + + + P Sbjct: 1013 AADTLTAAIVESEDSGFSESEAVPRPRSIRGKKPALEKTP 1052 >SB_15652| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 689 Score = 29.5 bits (63), Expect = 1.7 Identities = 21/73 (28%), Positives = 33/73 (45%) Frame = +3 Query: 204 AHYIHPTVPRTPDRWPPATRPPVPSFSGPRARFDGAALHLSPERSGERGLPSPGFLLRVS 383 A H VP+ PP RP + + + +ALH+SPE G++G +P Sbjct: 611 ADLTHNAVPQRARATPPPPRPYLATAA--------SALHVSPEEPGKQGPSTP----EAM 658 Query: 384 VQSTPPHVWVSPR 422 + +PP+ PR Sbjct: 659 ILPSPPNAVERPR 671 >SB_26370| Best HMM Match : Drf_FH1 (HMM E-Value=5.2) Length = 190 Score = 29.1 bits (62), Expect = 2.3 Identities = 13/25 (52%), Positives = 15/25 (60%), Gaps = 1/25 (4%) Frame = +3 Query: 210 YIHPTVPRTPDRWPPA-TRPPVPSF 281 Y+HP VP TP P PPVP+F Sbjct: 77 YLHPIVPSTPSTCIPLYPVPPVPAF 101 >SB_34695| Best HMM Match : CXC (HMM E-Value=4.7) Length = 186 Score = 29.1 bits (62), Expect = 2.3 Identities = 20/67 (29%), Positives = 24/67 (35%) Frame = +3 Query: 162 PVGAIETAGQG*RRAHYIHPTVPRTPDRWPPATRPPVPSFSGPRARFDGAALHLSPERSG 341 PVGA AG R H P R P R P + A H + SG Sbjct: 87 PVGAHNMAGGHPRVQHVTDPGFDRVPSRRQSKDSAPAKVHAEGEAPAPSPRTHAAHSMSG 146 Query: 342 ERGLPSP 362 E+G +P Sbjct: 147 EKGDHTP 153 >SB_58586| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 277 Score = 28.7 bits (61), Expect = 3.0 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = -3 Query: 254 WRPPVRRPWDGGMDVMCSASTLSRRFNSP 168 WR PVR+ WDG + V S + R P Sbjct: 118 WRKPVRQLWDGVLRVFSSTTQQKRPQEGP 146 >SB_50198| Best HMM Match : Frizzled (HMM E-Value=0) Length = 654 Score = 28.7 bits (61), Expect = 3.0 Identities = 14/37 (37%), Positives = 20/37 (54%) Frame = -1 Query: 385 TLTRNRKPGDGRPRSPDRSGERCNAAPSKRALGPLNE 275 TL +R P G P++ + C AAP+ + PLNE Sbjct: 129 TLDCDRLPKKGDPQAKSDPTKLCMAAPNIKQTAPLNE 165 >SB_6516| Best HMM Match : DUF708 (HMM E-Value=8.5) Length = 159 Score = 28.7 bits (61), Expect = 3.0 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = -3 Query: 254 WRPPVRRPWDGGMDVMCSASTLSRRFNSP 168 WR PVR+ WDG + V S + R P Sbjct: 118 WRKPVRQLWDGVLRVFSSTTQQKRPQEGP 146 >SB_58063| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 171 Score = 28.3 bits (60), Expect = 4.0 Identities = 19/63 (30%), Positives = 22/63 (34%) Frame = +3 Query: 162 PVGAIETAGQG*RRAHYIHPTVPRTPDRWPPATRPPVPSFSGPRARFDGAALHLSPERSG 341 PVGA AG R H P R P R P + A H + SG Sbjct: 87 PVGAHNMAGGHPRVQHVTDPGFDRVPSRRQSKDSAPAKVHAEGEAPAPSPRTHAAHSMSG 146 Query: 342 ERG 350 E+G Sbjct: 147 EKG 149 >SB_51829| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1414 Score = 28.3 bits (60), Expect = 4.0 Identities = 30/110 (27%), Positives = 41/110 (37%), Gaps = 2/110 (1%) Frame = +3 Query: 45 HRRKSPDPHPRGRWGMWELNLTKNSCRSQPAPYL--GPGRSPVGAIETAGQG*RRAHYIH 218 HRR DP R E ++ ++ R P + G GR + G+ R Y Sbjct: 638 HRRPYDDPEGLERESRGERDVRRDDPREDRRPGMSEGRGRDRPERPDRTGERGREPRYST 697 Query: 219 PTVPRTPDRWPPATRPPVPSFSGPRARFDGAALHLSPERSGERGLPSPGF 368 P P R P+ PP P + P G + S R +R P GF Sbjct: 698 PQGPDYHRR--PSPSPPGPPRNAPYGPPRGRSPPPS-HRFDDRRRPDEGF 744 >SB_48709| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 931 Score = 28.3 bits (60), Expect = 4.0 Identities = 20/63 (31%), Positives = 23/63 (36%), Gaps = 1/63 (1%) Frame = +3 Query: 219 PTVPRTPDRWPPATRPPVPSFSGPRAR-FDGAALHLSPERSGERGLPSPGFLLRVSVQST 395 PT PP + PP S SGP G P G R +P PG + Sbjct: 233 PTSDPNMGHHPPISGPPTTSMSGPPIPVHHGMPPQYGP---GRRDMPPPGAPPGMLPPGM 289 Query: 396 PPH 404 PPH Sbjct: 290 PPH 292 >SB_42166| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 116 Score = 28.3 bits (60), Expect = 4.0 Identities = 21/62 (33%), Positives = 26/62 (41%), Gaps = 1/62 (1%) Frame = +3 Query: 213 IHPTVPRTPDRWPPATRPPVPSF-SGPRARFDGAALHLSPERSGERGLPSPGFLLRVSVQ 389 + PT D WPP T PP S+ + AR D + L +GE P G L V Sbjct: 33 VKPTTKPVTD-WPPYTHPPFASWRNSEEARTDRPSQQLR-SLNGEWDAPCSGALSAAGVV 90 Query: 390 ST 395 T Sbjct: 91 VT 92 >SB_25723| Best HMM Match : Vicilin_N (HMM E-Value=0.0045) Length = 2506 Score = 28.3 bits (60), Expect = 4.0 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = +3 Query: 225 VPRTPDRWPPATRPPVPSFSGPRARFDGAA 314 VPR D RPP P F G R R D A Sbjct: 1169 VPRESDFLSVLNRPPTPRFLGHRKRTDSLA 1198 >SB_25350| Best HMM Match : Collagen (HMM E-Value=0) Length = 1112 Score = 28.3 bits (60), Expect = 4.0 Identities = 16/48 (33%), Positives = 20/48 (41%) Frame = +3 Query: 219 PTVPRTPDRWPPATRPPVPSFSGPRARFDGAALHLSPERSGERGLPSP 362 P + P R P P P SGP + +P R GE G+P P Sbjct: 656 PGMSGPPGRPGPPGPPGPPGPSGPSGSNGRNGVKGTPGRDGEPGIPGP 703 >SB_21874| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 608 Score = 28.3 bits (60), Expect = 4.0 Identities = 16/44 (36%), Positives = 19/44 (43%), Gaps = 2/44 (4%) Frame = -3 Query: 275 GNRWSCRWRPPVRRPWDG--GMDVMCSASTLSRRFNSPDWAPAR 150 G R +C WR +R WDG GM + C R N W R Sbjct: 229 GMRINCNWRKGMRINWDGWEGMRINCD-EWEGMRINWDGWEGMR 271 >SB_12635| Best HMM Match : Chlam_PMP (HMM E-Value=0.018) Length = 3561 Score = 28.3 bits (60), Expect = 4.0 Identities = 22/62 (35%), Positives = 24/62 (38%), Gaps = 1/62 (1%) Frame = -1 Query: 400 GGVLCTLTRNRKPGDGRPRSPDRSGERCNAAPSKRALGPLNEGTG-GRVAGGHRSGVRGT 224 G L L RN D S D +G A GP N+G G G GG G GT Sbjct: 1645 GSDLRILARNISINDAGSLSLDGAGYSTAHASKSGVNGPANKGIGKGTEPGGSGGGHGGT 1704 Query: 223 VG 218 G Sbjct: 1705 GG 1706 >SB_40573| Best HMM Match : RRM_1 (HMM E-Value=1.8e-39) Length = 507 Score = 28.3 bits (60), Expect = 4.0 Identities = 16/48 (33%), Positives = 21/48 (43%) Frame = +1 Query: 157 GAQSGLLKRRDRVDAEHITSIPPSHGRRTGGRQRHDHRFPRSAGREPA 300 G S + + D H S PS RR+ R R R P+S R P+ Sbjct: 444 GETSYIRVKSDLQSRSHSRSRSPSPRRRSRSRSRSPRRRPKSYSRSPS 491 >SB_32181| Best HMM Match : CUB (HMM E-Value=0) Length = 588 Score = 28.3 bits (60), Expect = 4.0 Identities = 11/26 (42%), Positives = 14/26 (53%) Frame = +1 Query: 415 LPAQNGWDP*LLGGQVTDTTPVPTPW 492 + A GWD + DT+P PTPW Sbjct: 528 ISAAFGWDIISIEPYTLDTSPTPTPW 553 >SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69) Length = 472 Score = 27.9 bits (59), Expect = 5.3 Identities = 12/25 (48%), Positives = 16/25 (64%), Gaps = 1/25 (4%) Frame = +3 Query: 210 YIHPTVPRTPDRWPPA-TRPPVPSF 281 Y+H VP TP+ + P PPVP+F Sbjct: 55 YLHSIVPSTPNTYIPLYPVPPVPTF 79 Score = 27.5 bits (58), Expect = 6.9 Identities = 12/25 (48%), Positives = 15/25 (60%), Gaps = 1/25 (4%) Frame = +3 Query: 210 YIHPTVPRTPDRWPPA-TRPPVPSF 281 Y+H VP TP + P PPVP+F Sbjct: 151 YLHSIVPSTPSTYIPLYPVPPVPAF 175 Score = 27.1 bits (57), Expect = 9.2 Identities = 11/25 (44%), Positives = 15/25 (60%), Gaps = 1/25 (4%) Frame = +3 Query: 210 YIHPTVPRTPDRWPPA-TRPPVPSF 281 Y+H VP TP + P PP+P+F Sbjct: 119 YLHSIVPSTPSTYIPLYPVPPIPTF 143 Score = 27.1 bits (57), Expect = 9.2 Identities = 11/25 (44%), Positives = 15/25 (60%), Gaps = 1/25 (4%) Frame = +3 Query: 210 YIHPTVPRTPDRWPPA-TRPPVPSF 281 Y+H VP TP + P PP+P+F Sbjct: 279 YLHSIVPSTPSTYIPLYPVPPIPTF 303 >SB_13377| Best HMM Match : Extensin_2 (HMM E-Value=0.00046) Length = 797 Score = 27.9 bits (59), Expect = 5.3 Identities = 21/73 (28%), Positives = 30/73 (41%), Gaps = 4/73 (5%) Frame = +3 Query: 219 PTVPRTPDRWPPATRPPVPSFSGPRARFDGAA---LHLSPERSGERGLPSPGFLLRVSV- 386 P T R + R PVP+++ PR + SP P P + R ++ Sbjct: 583 PVPAYTTPRVLHSPRTPVPAYTSPRVHHSPRTPLPAYTSPRVHHSPRTPLPAYSPRTTLP 642 Query: 387 QSTPPHVWVSPRT 425 +T P V SPRT Sbjct: 643 ANTTPRVHHSPRT 655 >SB_43407| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 258 Score = 27.9 bits (59), Expect = 5.3 Identities = 17/63 (26%), Positives = 24/63 (38%), Gaps = 1/63 (1%) Frame = +3 Query: 219 PTVPRTPDRWPPATRPPVPSFSGPRARFDG-AALHLSPERSGERGLPSPGFLLRVSVQST 395 P P P+ P PP+ S S R G A H + + + G P P + Sbjct: 192 PGAPEPPEPDNPPASPPMASLSQDRHSASGNAVTHPTSQENSYTGPPPPPYTSLPPDDPP 251 Query: 396 PPH 404 PP+ Sbjct: 252 PPY 254 >SB_48061| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 307 Score = 27.5 bits (58), Expect = 6.9 Identities = 23/77 (29%), Positives = 35/77 (45%), Gaps = 5/77 (6%) Frame = +3 Query: 93 WELNLTKNSCRSQPAPYLGPGRSPVGAIETAGQG*---RRAHYIHPTVPRTPDR--WPPA 257 WEL ++ + P P+L G P + QG +R+ +H P PD+ PP Sbjct: 167 WELPRVPSANATLP-PHLQYGPPPPTSPGLCNQGYNLHQRSQPVHSMEP-FPDQPPGPPP 224 Query: 258 TRPPVPSFSGPRARFDG 308 PP+P F + +F G Sbjct: 225 GPPPLPDFRTLQGKFPG 241 >SB_45789| Best HMM Match : E-MAP-115 (HMM E-Value=1.8) Length = 519 Score = 27.5 bits (58), Expect = 6.9 Identities = 13/37 (35%), Positives = 17/37 (45%) Frame = +3 Query: 219 PTVPRTPDRWPPATRPPVPSFSGPRARFDGAALHLSP 329 P +P P PP PP P+ + P A L L+P Sbjct: 35 PPIPHGPRPLPPLREPPTPAPTPPPALPSTPTLPLAP 71 >SB_33219| Best HMM Match : RhoGAP (HMM E-Value=0.0014) Length = 399 Score = 27.5 bits (58), Expect = 6.9 Identities = 15/42 (35%), Positives = 19/42 (45%) Frame = -1 Query: 364 PGDGRPRSPDRSGERCNAAPSKRALGPLNEGTGGRVAGGHRS 239 P GRP SP G + P K + + GG AGG +S Sbjct: 243 PRPGRPPSPSTRGMKPLPPPKKPDVVAEKDQKGGNEAGGTKS 284 >SB_23536| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 414 Score = 27.5 bits (58), Expect = 6.9 Identities = 17/40 (42%), Positives = 20/40 (50%), Gaps = 3/40 (7%) Frame = +3 Query: 252 PATRPPVPSFSGPRARFDGAALHLSPERS---GERGLPSP 362 P RPP PS+S R + + PERS GERG P Sbjct: 161 PRERPPPPSYSSERVGYGDK--YPPPERSYSGGERGYGPP 198 >SB_20893| Best HMM Match : 7tm_1 (HMM E-Value=1.5e-23) Length = 435 Score = 27.5 bits (58), Expect = 6.9 Identities = 13/33 (39%), Positives = 21/33 (63%) Frame = -1 Query: 394 VLCTLTRNRKPGDGRPRSPDRSGERCNAAPSKR 296 ++C LTR+R PG+ + + +S R AA S+R Sbjct: 165 IICRLTRHRMPGEEQV-AGQQSHSRAQAAKSRR 196 >SB_58392| Best HMM Match : Peptidase_M16_C (HMM E-Value=1.2e-24) Length = 1064 Score = 27.5 bits (58), Expect = 6.9 Identities = 11/18 (61%), Positives = 12/18 (66%) Frame = -1 Query: 397 GVLCTLTRNRKPGDGRPR 344 G C L RNRKP +GR R Sbjct: 875 GPCCELNRNRKPEEGRSR 892 >SB_21796| Best HMM Match : COLFI (HMM E-Value=0) Length = 1239 Score = 27.5 bits (58), Expect = 6.9 Identities = 11/23 (47%), Positives = 13/23 (56%) Frame = -2 Query: 219 DGCNVLCVNPVPPFQ*PRLGSGP 151 DGC+ CV P+PP P GP Sbjct: 81 DGCDFRCVPPIPPPTPPPQRRGP 103 >SB_3045| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 825 Score = 27.5 bits (58), Expect = 6.9 Identities = 11/23 (47%), Positives = 13/23 (56%) Frame = +3 Query: 210 YIHPTVPRTPDRWPPATRPPVPS 278 Y H T PR +PP PPVP+ Sbjct: 256 YGHSTYPRYGGGYPPNLHPPVPA 278 >SB_51860| Best HMM Match : ShTK (HMM E-Value=1.5e-09) Length = 197 Score = 27.1 bits (57), Expect = 9.2 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = +3 Query: 222 TVPRTPDRWPPATRPPVPSFSGPRARFDG 308 T+P TP PP T PP P+ + DG Sbjct: 125 TLPPTPATLPPTTVPPAPAPVPDKGFVDG 153 >SB_46164| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 784 Score = 27.1 bits (57), Expect = 9.2 Identities = 20/72 (27%), Positives = 31/72 (43%), Gaps = 5/72 (6%) Frame = +1 Query: 175 LKRRDRVDAEHITSIPPSHGR---RTGGRQRHDHRFPRSAGREPALMAPRYT--FPQSGQ 339 L+R + DAEH T+ P +H + + G++ D + ++A T P S Sbjct: 110 LRRHQKSDAEHFTNFPYNHVQFYYNSSGQRGQDGGSSKGPMSPNDVLAAVKTPVSPVSSN 169 Query: 340 GNAVYHHPASYC 375 G A H S C Sbjct: 170 GTAFSEHGGSPC 181 >SB_36280| Best HMM Match : Dehydrin (HMM E-Value=4.4) Length = 426 Score = 27.1 bits (57), Expect = 9.2 Identities = 25/81 (30%), Positives = 32/81 (39%) Frame = +1 Query: 55 NRRIPTRAAGGVCGS*TSLKTPAAHNRRPTSDRAGAQSGLLKRRDRVDAEHITSIPPSHG 234 +R P R G +S + P+A R +SD + + RRD H S S Sbjct: 42 SRESPERKRPSSLGRDSSERRPSA---RVSSDNSRSPP---HRRDSSRRSHSPSRRSSDD 95 Query: 235 RRTGGRQRHDHRFPRSAGREP 297 R T R R D R S R P Sbjct: 96 RSTDARDRRDRRRSSSRERRP 116 >SB_26920| Best HMM Match : Rap_GAP (HMM E-Value=6.9e-29) Length = 1890 Score = 27.1 bits (57), Expect = 9.2 Identities = 13/37 (35%), Positives = 17/37 (45%) Frame = -1 Query: 412 TQTWGGVLCTLTRNRKPGDGRPRSPDRSGERCNAAPS 302 T GG T N K G RP++P+ G + PS Sbjct: 641 TDGTGGTKAERTLNEKAGKERPKTPEPQGTGESTTPS 677 >SB_43036| Best HMM Match : Chorion_3 (HMM E-Value=1.6) Length = 621 Score = 27.1 bits (57), Expect = 9.2 Identities = 18/62 (29%), Positives = 22/62 (35%) Frame = +3 Query: 162 PVGAIETAGQG*RRAHYIHPTVPRTPDRWPPATRPPVPSFSGPRARFDGAALHLSPERSG 341 PVGA AG R H P + R P R P + A H + SG Sbjct: 537 PVGAQNMAGGHPRVQHVTDPGIDRVPSRRQSMDSAPAKVHAEGAAPAPSPRTHAAHSMSG 596 Query: 342 ER 347 E+ Sbjct: 597 EK 598 >SB_32600| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1572 Score = 27.1 bits (57), Expect = 9.2 Identities = 26/97 (26%), Positives = 34/97 (35%), Gaps = 1/97 (1%) Frame = +3 Query: 132 PAPYLGPGRSPVGAIETAGQG*RRAHYIHPTVPRTPDRWPPATRPPVPSFSGPRARFDGA 311 P P + P +P + G +R Y PR P PP R P P R Sbjct: 587 PHPRVPPPGAPHPKVPPPGAPYQRLPYSGAYHPRLPPPGPPYQRVPPPGAPIQRVPLPET 646 Query: 312 ALHLSP-ERSGERGLPSPGFLLRVSVQSTPPHVWVSP 419 P R+ G PSP + + P V +SP Sbjct: 647 HHQRVPYSRATHHGEPSP------RIPTVTPRVPISP 677 >SB_17926| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1078 Score = 27.1 bits (57), Expect = 9.2 Identities = 13/32 (40%), Positives = 18/32 (56%) Frame = +2 Query: 272 SLVQRAESPL*WRRVTPFPRAVRGTRSTITRL 367 S+ RAESP+ W +TP A+R S R+ Sbjct: 816 SMTDRAESPIFWPGITPAITALRERCSHCNRM 847 >SB_9876| Best HMM Match : TSNR_N (HMM E-Value=7.6) Length = 197 Score = 27.1 bits (57), Expect = 9.2 Identities = 14/41 (34%), Positives = 20/41 (48%) Frame = +3 Query: 111 KNSCRSQPAPYLGPGRSPVGAIETAGQG*RRAHYIHPTVPR 233 K+ P P L R+ V +IE+ G+G R+ P V R Sbjct: 94 KSKLPEPPPPSLKVRRATVASIESLGEGHRKGSLFMPPVQR 134 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,651,318 Number of Sequences: 59808 Number of extensions: 489301 Number of successful extensions: 1802 Number of sequences better than 10.0: 45 Number of HSP's better than 10.0 without gapping: 1539 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1784 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1148326654 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -