BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30713 (517 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g43710.2 68415.m05434 acyl-[acyl-carrier-protein] desaturase ... 33 0.15 At2g43710.1 68415.m05433 acyl-[acyl-carrier-protein] desaturase ... 33 0.15 At1g68790.1 68414.m07863 expressed protein 32 0.26 At3g51620.2 68416.m05659 expressed protein 31 0.46 At3g51620.1 68416.m05658 expressed protein 31 0.46 At2g24740.1 68415.m02955 SET domain-containing protein (SUVH8) i... 30 1.1 At5g50220.1 68418.m06220 F-box family protein contains F-box dom... 28 3.2 At4g01985.1 68417.m00265 expressed protein 28 3.2 At1g17540.1 68414.m02157 protein kinase-related similar to serin... 28 3.2 At2g26520.1 68415.m03182 expressed protein 28 4.3 At1g70460.1 68414.m08107 protein kinase, putative contains Pfam ... 28 4.3 At4g18670.1 68417.m02762 leucine-rich repeat family protein / ex... 27 5.7 At4g17620.1 68417.m02636 glycine-rich protein 27 5.7 At4g13350.2 68417.m02088 human Rev interacting-like protein-rela... 27 5.7 At4g13350.1 68417.m02087 human Rev interacting-like protein-rela... 27 5.7 At5g38560.1 68418.m04662 protein kinase family protein contains ... 27 7.5 At3g27690.1 68416.m03457 chlorophyll A-B binding protein (LHCB2:... 27 7.5 At2g27380.1 68415.m03302 proline-rich family protein contains pr... 27 7.5 At2g06210.2 68415.m00683 phosphoprotein-related low similarity t... 27 7.5 At2g06210.1 68415.m00684 phosphoprotein-related low similarity t... 27 7.5 At5g62640.1 68418.m07862 proline-rich family protein contains pr... 27 9.9 At5g44180.1 68418.m05406 homeobox transcription factor, putative... 27 9.9 At4g05150.1 68417.m00773 octicosapeptide/Phox/Bem1p (PB1) domain... 27 9.9 At4g04545.1 68417.m00665 Ulp1 protease family protein contains P... 27 9.9 At2g17200.1 68415.m01986 ubiquitin family protein weak similarit... 27 9.9 >At2g43710.2 68415.m05434 acyl-[acyl-carrier-protein] desaturase / stearoyl-ACP desaturase (SSI2) identical to gi:15149310; contains Pfam profile PF03405: Fatty acid desaturase; identical to cDNA stearoyl ACP desaturase (SSI2), SSI2-FAB2 allele, GI:15149309 Length = 401 Score = 32.7 bits (71), Expect = 0.15 Identities = 12/26 (46%), Positives = 17/26 (65%) Frame = +3 Query: 216 HPTVPRTPDRWPPATRPPVPSFSGPR 293 +P V P ++P +TRPP PSF P+ Sbjct: 6 NPLVASQPYKFPSSTRPPTPSFRSPK 31 >At2g43710.1 68415.m05433 acyl-[acyl-carrier-protein] desaturase / stearoyl-ACP desaturase (SSI2) identical to gi:15149310; contains Pfam profile PF03405: Fatty acid desaturase; identical to cDNA stearoyl ACP desaturase (SSI2), SSI2-FAB2 allele, GI:15149309 Length = 401 Score = 32.7 bits (71), Expect = 0.15 Identities = 12/26 (46%), Positives = 17/26 (65%) Frame = +3 Query: 216 HPTVPRTPDRWPPATRPPVPSFSGPR 293 +P V P ++P +TRPP PSF P+ Sbjct: 6 NPLVASQPYKFPSSTRPPTPSFRSPK 31 >At1g68790.1 68414.m07863 expressed protein Length = 1085 Score = 31.9 bits (69), Expect = 0.26 Identities = 23/68 (33%), Positives = 31/68 (45%), Gaps = 1/68 (1%) Frame = -1 Query: 442 RGPTRFVRGETQTWGGVLCTLTRNRKPGDGR-PRSPDRSGERCNAAPSKRALGPLNEGTG 266 RG + VRG +Q V +R+ KP DG PR R + S++A G +EG Sbjct: 861 RGRGKSVRGRSQATKAV----SRDSKPSDGETPRKRQRE-QTSRITESEQAAGDSDEGVD 915 Query: 265 GRVAGGHR 242 GG R Sbjct: 916 SITTGGRR 923 >At3g51620.2 68416.m05659 expressed protein Length = 542 Score = 31.1 bits (67), Expect = 0.46 Identities = 20/63 (31%), Positives = 24/63 (38%), Gaps = 1/63 (1%) Frame = +1 Query: 247 GRQRHDHRFPRSAGREPALMAPRYTFPQSGQGNAVYHHPASYCG*ACRARHPTS-GSLPA 423 GR H R PR+ GR + FP H+P G +C H S S P Sbjct: 407 GRNSHQARSPRNNGRSMSQAHSEMNFPDRNTRERQLHYPNQTNG-SCDMSHTDSLDSFPD 465 Query: 424 QNG 432 NG Sbjct: 466 TNG 468 >At3g51620.1 68416.m05658 expressed protein Length = 755 Score = 31.1 bits (67), Expect = 0.46 Identities = 20/63 (31%), Positives = 24/63 (38%), Gaps = 1/63 (1%) Frame = +1 Query: 247 GRQRHDHRFPRSAGREPALMAPRYTFPQSGQGNAVYHHPASYCG*ACRARHPTS-GSLPA 423 GR H R PR+ GR + FP H+P G +C H S S P Sbjct: 633 GRNSHQARSPRNNGRSMSQAHSEMNFPDRNTRERQLHYPNQTNG-SCDMSHTDSLDSFPD 691 Query: 424 QNG 432 NG Sbjct: 692 TNG 694 >At2g24740.1 68415.m02955 SET domain-containing protein (SUVH8) identical to SUVH8 [Arabidopsis thaliana] GI:13517757; contains Pfam profiles PF00856: SET domain, PF05033: Pre-SET motif, PF02182: YDG/SRA domain Length = 755 Score = 29.9 bits (64), Expect = 1.1 Identities = 20/48 (41%), Positives = 23/48 (47%) Frame = +1 Query: 43 STGENRRIPTRAAGGVCGS*TSLKTPAAHNRRPTSDRAGAQSGLLKRR 186 STG +R R G GS K P A++ T AG SGL KRR Sbjct: 169 STGPGKRGRGRPKGSKNGS-RKPKKPKAYDNNSTDASAGPSSGLGKRR 215 >At5g50220.1 68418.m06220 F-box family protein contains F-box domain Pfam:PF00646 Length = 357 Score = 28.3 bits (60), Expect = 3.2 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = +3 Query: 117 SCRSQPAPYLGPGRSPVGAIETAGQG*RRAHYIH 218 SC++ Y GP R+ + +E G RR H +H Sbjct: 310 SCQTLYVYYYGPKRNSMRRVEVEGTKYRRKHLVH 343 >At4g01985.1 68417.m00265 expressed protein Length = 579 Score = 28.3 bits (60), Expect = 3.2 Identities = 18/48 (37%), Positives = 19/48 (39%) Frame = -1 Query: 361 GDGRPRSPDRSGERCNAAPSKRALGPLNEGTGGRVAGGHRSGVRGTVG 218 G G G A S A G + G GG V GG GV G VG Sbjct: 316 GSGGASGGASGGASGGAGGSVGAGGGVGGGVGGGVGGGVGGGVGGAVG 363 Score = 27.9 bits (59), Expect = 4.3 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = -1 Query: 289 GPLNEGTGGRVAGGHRSGVRGTVG 218 G G GG V GG GVRG VG Sbjct: 494 GGAGGGVGGGVGGGVGGGVRGAVG 517 >At1g17540.1 68414.m02157 protein kinase-related similar to serine/threonine protein kinase Fen [Lycopersicon esculentum] GI:1809259 Length = 733 Score = 28.3 bits (60), Expect = 3.2 Identities = 15/51 (29%), Positives = 23/51 (45%), Gaps = 1/51 (1%) Frame = +3 Query: 219 PTVPRTPDRWP-PATRPPVPSFSGPRARFDGAALHLSPERSGERGLPSPGF 368 P P+ P P P+ P + S GP + + SP +GE P+P + Sbjct: 172 PQTPQAPQHPPHPSKHPSMMSDPGPTSSTSSESGRSSPALNGELSPPTPHY 222 >At2g26520.1 68415.m03182 expressed protein Length = 145 Score = 27.9 bits (59), Expect = 4.3 Identities = 16/46 (34%), Positives = 22/46 (47%) Frame = +3 Query: 210 YIHPTVPRTPDRWPPATRPPVPSFSGPRARFDGAALHLSPERSGER 347 +IHP P +P PP +P + SG A +G L E GE+ Sbjct: 83 HIHPHRP-SPSPTPPPRQPLHHTSSGVSAESEGHVADLDHETDGEK 127 >At1g70460.1 68414.m08107 protein kinase, putative contains Pfam PF00069: Protein kinase domain Length = 710 Score = 27.9 bits (59), Expect = 4.3 Identities = 30/95 (31%), Positives = 37/95 (38%), Gaps = 3/95 (3%) Frame = +3 Query: 126 SQPAPYLGPGRSPVGAIETAGQG*RRAHYIHP-TVPRTPDRWPPATRPPVPSFSGPRARF 302 S PAP P + G + H+ P T P P PAT PP P + PR Sbjct: 136 SPPAPPPPEQLPPPASSPQGGPKKPKKHHPGPATSPPAPSA--PATSPPAPPNAPPR--- 190 Query: 303 DGAALHLSPERSGERG--LPSPGFLLRVSVQSTPP 401 + H P +S G L SP + S S PP Sbjct: 191 --NSSHALPPKSTAAGGPLTSPSRGVPSSGNSVPP 223 >At4g18670.1 68417.m02762 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 839 Score = 27.5 bits (58), Expect = 5.7 Identities = 13/29 (44%), Positives = 15/29 (51%), Gaps = 1/29 (3%) Frame = +3 Query: 207 HYIHPTVPRTP-DRWPPATRPPVPSFSGP 290 HYI P P TP PP + PP +S P Sbjct: 731 HYISPPPPPTPIHSPPPQSHPPCIEYSPP 759 >At4g17620.1 68417.m02636 glycine-rich protein Length = 544 Score = 27.5 bits (58), Expect = 5.7 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = +2 Query: 134 GALPRTGPEPSRGY*NGGTG 193 G LPR GP P RG GG G Sbjct: 166 GLLPRPGPYPGRGGNRGGFG 185 >At4g13350.2 68417.m02088 human Rev interacting-like protein-related / hRIP protein-related similar to SP|P52594 Nucleoporin-like protein RIP (HIV-1 Rev-binding protein) (Rev interacting protein) (Rev/Rex activation domain-binding protein) {Homo sapiens}; contains Pfam profile PF01412: Putative GTPase activating protein for Arf Length = 602 Score = 27.5 bits (58), Expect = 5.7 Identities = 14/32 (43%), Positives = 18/32 (56%) Frame = +2 Query: 134 GALPRTGPEPSRGY*NGGTGLTQSTLHPSHRP 229 GALP +G PS+G N +Q + HPS P Sbjct: 512 GALPPSGMMPSQGVHNQFNIPSQGSAHPSAMP 543 >At4g13350.1 68417.m02087 human Rev interacting-like protein-related / hRIP protein-related similar to SP|P52594 Nucleoporin-like protein RIP (HIV-1 Rev-binding protein) (Rev interacting protein) (Rev/Rex activation domain-binding protein) {Homo sapiens}; contains Pfam profile PF01412: Putative GTPase activating protein for Arf Length = 602 Score = 27.5 bits (58), Expect = 5.7 Identities = 14/32 (43%), Positives = 18/32 (56%) Frame = +2 Query: 134 GALPRTGPEPSRGY*NGGTGLTQSTLHPSHRP 229 GALP +G PS+G N +Q + HPS P Sbjct: 512 GALPPSGMMPSQGVHNQFNIPSQGSAHPSAMP 543 >At5g38560.1 68418.m04662 protein kinase family protein contains protein kinase domain, Pfam:PF00069 Length = 681 Score = 27.1 bits (57), Expect = 7.5 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +3 Query: 222 TVPRTPDRWPPATRPPVPSFSGP 290 T P TP PP T PP P S P Sbjct: 27 TQPTTPSAPPPVTPPPSPPQSPP 49 >At3g27690.1 68416.m03457 chlorophyll A-B binding protein (LHCB2:4) nearly identical to Lhcb2 protein [Arabidopsis thaliana] GI:4741950; similar to chlorophyll A-B binding protein 151 precursor (LHCP) GB:P27518 from [Gossypium hirsutum]; contains Pfam PF00504: Chlorophyll A-B binding protein Length = 266 Score = 27.1 bits (57), Expect = 7.5 Identities = 11/27 (40%), Positives = 18/27 (66%), Gaps = 1/27 (3%) Frame = +3 Query: 369 LLRVSVQSTPPHVWVSP-RTKRVGPLA 446 ++R +V+STP +W P R K +GP + Sbjct: 37 IMRRTVKSTPQSIWYGPDRPKYLGPFS 63 >At2g27380.1 68415.m03302 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 761 Score = 27.1 bits (57), Expect = 7.5 Identities = 10/24 (41%), Positives = 14/24 (58%) Frame = +3 Query: 219 PTVPRTPDRWPPATRPPVPSFSGP 290 PT +P PP +PP P++S P Sbjct: 462 PTPTYSPPIKPPPVKPPTPTYSPP 485 Score = 27.1 bits (57), Expect = 7.5 Identities = 10/24 (41%), Positives = 14/24 (58%) Frame = +3 Query: 219 PTVPRTPDRWPPATRPPVPSFSGP 290 PT +P PP +PP P++S P Sbjct: 512 PTPTYSPPIKPPPVKPPTPTYSPP 535 >At2g06210.2 68415.m00683 phosphoprotein-related low similarity to phosphoprotein from Mus musculus GI:1236239; contains Pfam profile PF00515 TPR Domain Length = 852 Score = 27.1 bits (57), Expect = 7.5 Identities = 13/38 (34%), Positives = 21/38 (55%) Frame = +1 Query: 169 GLLKRRDRVDAEHITSIPPSHGRRTGGRQRHDHRFPRS 282 G KR+DRV+ + S P R+ GG++R + R+ Sbjct: 693 GSNKRKDRVEDDDGESKPSERRRKKGGKRRKKDKSSRA 730 >At2g06210.1 68415.m00684 phosphoprotein-related low similarity to phosphoprotein from Mus musculus GI:1236239; contains Pfam profile PF00515 TPR Domain Length = 1064 Score = 27.1 bits (57), Expect = 7.5 Identities = 13/38 (34%), Positives = 21/38 (55%) Frame = +1 Query: 169 GLLKRRDRVDAEHITSIPPSHGRRTGGRQRHDHRFPRS 282 G KR+DRV+ + S P R+ GG++R + R+ Sbjct: 905 GSNKRKDRVEDDDGESKPSERRRKKGGKRRKKDKSSRA 942 >At5g62640.1 68418.m07862 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 520 Score = 26.6 bits (56), Expect = 9.9 Identities = 19/64 (29%), Positives = 27/64 (42%), Gaps = 2/64 (3%) Frame = +3 Query: 249 PPATRPPVPSFSGPRARFDGAAL--HLSPERSGERGLPSPGFLLRVSVQSTPPHVWVSPR 422 PP RPP+P P + DG A+ P + +P + R Q TP + P Sbjct: 389 PPMMRPPLPPGPPPSSFQDGQAMIRPYVPNKPSFVKSAAPTVVRRPLAQHTPELTSMVPA 448 Query: 423 TKRV 434 + RV Sbjct: 449 SVRV 452 >At5g44180.1 68418.m05406 homeobox transcription factor, putative similar to homeobox transcription factor Hox7/homeotic protein Hox7 (GI:19486) {Lycopersicon peruvianum}; similar to GP|4165087| Williams-Beuren syndrome deletion transcript 9 [Homo sapiens]; contains Pfam PF02791: DDT domain and Pfam PF00046: Homeobox domain Length = 1694 Score = 26.6 bits (56), Expect = 9.9 Identities = 15/42 (35%), Positives = 21/42 (50%) Frame = -1 Query: 385 TLTRNRKPGDGRPRSPDRSGERCNAAPSKRALGPLNEGTGGR 260 T+ R R G ++ RSG + P++ LG NE GGR Sbjct: 1505 TMLRPRAQPRGGRKNGRRSGTKGRKRPTQGTLGICNEVGGGR 1546 >At4g05150.1 68417.m00773 octicosapeptide/Phox/Bem1p (PB1) domain-containing protein various predicted proteins contains Pfam profile PF00564: PB1 domain Length = 477 Score = 26.6 bits (56), Expect = 9.9 Identities = 16/52 (30%), Positives = 24/52 (46%), Gaps = 6/52 (11%) Frame = +3 Query: 288 PRARFDGAALHLSPERSGERGLPSP------GFLLRVSVQSTPPHVWVSPRT 425 PRA+ LS S R +PSP ++R+S PP V++ P + Sbjct: 254 PRAKIQREVSTLSDPGSPRRDVPSPYGSTSSAPVMRISTPELPPPVFIKPES 305 >At4g04545.1 68417.m00665 Ulp1 protease family protein contains Pfam profile PF02902: Ulp1 protease family, C-terminal catalytic domain Length = 882 Score = 26.6 bits (56), Expect = 9.9 Identities = 21/58 (36%), Positives = 27/58 (46%) Frame = +3 Query: 162 PVGAIETAGQG*RRAHYIHPTVPRTPDRWPPATRPPVPSFSGPRARFDGAALHLSPER 335 PV +TA +G + H + P +W P PSF GP FD A+ SPER Sbjct: 598 PVQQRQTAVRGSTKVHVVRP------GKWEKIPPNPPPSFIGP---FDPFAVP-SPER 645 >At2g17200.1 68415.m01986 ubiquitin family protein weak similarity to PLIC-2 (ubiquitin-like type II) [Homo sapiens] GI:9937505; contains Pfam profiles PF00240: Ubiquitin family, PF00627: UBA/TS-N domain Length = 551 Score = 26.6 bits (56), Expect = 9.9 Identities = 12/35 (34%), Positives = 16/35 (45%) Frame = +1 Query: 403 TSGSLPAQNGWDP*LLGGQVTDTTPVPTPWLGGGG 507 T GS + N P G + + P+P PW GG Sbjct: 298 TQGSDASNNSSTPNAGTGTIPNANPLPNPWGATGG 332 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,888,418 Number of Sequences: 28952 Number of extensions: 330442 Number of successful extensions: 1215 Number of sequences better than 10.0: 25 Number of HSP's better than 10.0 without gapping: 998 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1200 length of database: 12,070,560 effective HSP length: 76 effective length of database: 9,870,208 effective search space used: 937669760 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -