BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30712 (803 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BT030267-1|ABN49406.1| 234|Drosophila melanogaster IP18403p pro... 31 2.4 AE014297-4492|AAF56978.3| 3731|Drosophila melanogaster CG15523-P... 31 2.4 >BT030267-1|ABN49406.1| 234|Drosophila melanogaster IP18403p protein. Length = 234 Score = 30.7 bits (66), Expect = 2.4 Identities = 18/59 (30%), Positives = 30/59 (50%) Frame = -3 Query: 414 SIQFSQSKALVNKNSDFVANKYIAVGRA*TVTLRLARLQPHNIFILLCKKFMLFYQNST 238 SI++ QS V++N+DF+ + + VG T+ A P +L C+ L + N T Sbjct: 124 SIEYLQSDFKVDENNDFILHPKVLVGCMRIDTVFRAEKVPKLQLLLCCQDIELNFVNQT 182 >AE014297-4492|AAF56978.3| 3731|Drosophila melanogaster CG15523-PA protein. Length = 3731 Score = 30.7 bits (66), Expect = 2.4 Identities = 18/59 (30%), Positives = 30/59 (50%) Frame = -3 Query: 414 SIQFSQSKALVNKNSDFVANKYIAVGRA*TVTLRLARLQPHNIFILLCKKFMLFYQNST 238 SI++ QS V++N+DF+ + + VG T+ A P +L C+ L + N T Sbjct: 2133 SIEYLQSDFKVDENNDFILHPKVLVGCMRIDTVFRAEKVPKLQLLLCCQDIELNFVNQT 2191 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 30,957,943 Number of Sequences: 53049 Number of extensions: 590083 Number of successful extensions: 852 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 839 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 852 length of database: 24,988,368 effective HSP length: 84 effective length of database: 20,532,252 effective search space used: 3757402116 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -