BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30710 (710 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292375-1|CAL23187.2| 311|Tribolium castaneum gustatory recept... 25 0.61 AY362543-1|AAQ63455.1| 677|Tribolium castaneum chitin synthase ... 24 1.4 AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ... 24 1.4 AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ... 24 1.4 AY008296-1|AAG22858.1| 556|Tribolium castaneum Dorsal protein. 24 1.4 >AM292375-1|CAL23187.2| 311|Tribolium castaneum gustatory receptor candidate 54 protein. Length = 311 Score = 25.0 bits (52), Expect = 0.61 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = -2 Query: 205 LPNPGFLLTKSYNTFLITKLFCILHLNINTSILI 104 L + GFLL S F + F I+HL++ L+ Sbjct: 190 LSSLGFLLYASKKQFTFEETFAIIHLSVFVYTLV 223 >AY362543-1|AAQ63455.1| 677|Tribolium castaneum chitin synthase protein. Length = 677 Score = 23.8 bits (49), Expect = 1.4 Identities = 10/20 (50%), Positives = 15/20 (75%), Gaps = 1/20 (5%) Frame = +2 Query: 620 IFLRD-ITFAKEKPPYVFFV 676 ++ RD +FA+ PPY+FFV Sbjct: 183 MYYRDECSFAESIPPYLFFV 202 >AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase protein. Length = 1464 Score = 23.8 bits (49), Expect = 1.4 Identities = 10/20 (50%), Positives = 15/20 (75%), Gaps = 1/20 (5%) Frame = +2 Query: 620 IFLRD-ITFAKEKPPYVFFV 676 ++ RD +FA+ PPY+FFV Sbjct: 416 MYYRDECSFAESIPPYLFFV 435 >AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase CHS2 protein. Length = 1464 Score = 23.8 bits (49), Expect = 1.4 Identities = 10/20 (50%), Positives = 15/20 (75%), Gaps = 1/20 (5%) Frame = +2 Query: 620 IFLRD-ITFAKEKPPYVFFV 676 ++ RD +FA+ PPY+FFV Sbjct: 416 MYYRDECSFAESIPPYLFFV 435 >AY008296-1|AAG22858.1| 556|Tribolium castaneum Dorsal protein. Length = 556 Score = 23.8 bits (49), Expect = 1.4 Identities = 11/29 (37%), Positives = 16/29 (55%) Frame = +1 Query: 22 GKRIFQIGPVVSEPIRNKQTNKSFLFIIL 108 GK + PVVSEPI +K+ + + L Sbjct: 218 GKFTVPLTPVVSEPIYDKKAMSDLMIVKL 246 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 164,424 Number of Sequences: 336 Number of extensions: 3628 Number of successful extensions: 9 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 18843005 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -