BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30710 (710 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BT001327-1|AAN71082.1| 162|Drosophila melanogaster AT17081p pro... 29 4.7 AE014134-2707|AAN10938.1| 2282|Drosophila melanogaster CG31817-P... 29 6.2 >BT001327-1|AAN71082.1| 162|Drosophila melanogaster AT17081p protein. Length = 162 Score = 29.5 bits (63), Expect = 4.7 Identities = 17/60 (28%), Positives = 25/60 (41%) Frame = -3 Query: 408 LSIVCTRKDKLHDRIIRFNNDCLSLWIDPMAKRSRWRSLTRWEEDLSWPNLDRRNTGYRR 229 +S+ T++ K R R S+W +RSRW +RW W R + RR Sbjct: 30 VSLKETKRLKWSQRSQRSQWSMWSMWSRRWNRRSRWNRRSRWNRRSRWNRRSRWSMRSRR 89 >AE014134-2707|AAN10938.1| 2282|Drosophila melanogaster CG31817-PA protein. Length = 2282 Score = 29.1 bits (62), Expect = 6.2 Identities = 9/14 (64%), Positives = 13/14 (92%) Frame = +2 Query: 440 DCTCSTYTYYDKAI 481 DCTCST++Y+DK + Sbjct: 2185 DCTCSTHSYHDKDV 2198 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 29,034,777 Number of Sequences: 53049 Number of extensions: 573254 Number of successful extensions: 1249 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1232 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1248 length of database: 24,988,368 effective HSP length: 83 effective length of database: 20,585,301 effective search space used: 3149551053 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -