BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30710 (710 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY656663-1|AAT68000.1| 148|Apis mellifera pteropsin protein. 23 2.2 AF498306-5|AAM19330.1| 456|Apis mellifera dopamine receptor typ... 23 3.8 >AY656663-1|AAT68000.1| 148|Apis mellifera pteropsin protein. Length = 148 Score = 23.4 bits (48), Expect = 2.2 Identities = 14/43 (32%), Positives = 24/43 (55%), Gaps = 2/43 (4%) Frame = +1 Query: 52 VSEPIRNKQTNKSFLFI--ILV*MY*CLGAKCKIVL*LKRCCK 174 V +P+ N T FLF+ ++V ++ + + IVL LK+ K Sbjct: 55 VHDPVTNSDTYIGFLFVLGLIVPVFTIVSSYAAIVLTLKKVRK 97 >AF498306-5|AAM19330.1| 456|Apis mellifera dopamine receptor type D2 protein. Length = 456 Score = 22.6 bits (46), Expect = 3.8 Identities = 8/24 (33%), Positives = 13/24 (54%) Frame = -1 Query: 257 WIDVTQDIDAWASLEESFTQSGVL 186 W+ T D W SL+ F+ + +L Sbjct: 112 WLFTTDWCDVWRSLDVLFSTASIL 135 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 195,161 Number of Sequences: 438 Number of extensions: 4183 Number of successful extensions: 7 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 21926700 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -