BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30708 (734 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ666693-1|ABG29167.1| 250|Apis mellifera MAX dimerization prot... 22 5.2 DQ288391-1|ABC41341.1| 630|Apis mellifera vasa protein protein. 22 5.2 DQ151547-1|ABA39280.1| 405|Apis mellifera tyramine receptor pro... 22 5.2 DQ026034-1|AAY87893.1| 569|Apis mellifera nicotinic acetylcholi... 21 9.1 DQ026033-1|AAY87892.1| 569|Apis mellifera nicotinic acetylcholi... 21 9.1 AF069739-1|AAC63272.2| 690|Apis mellifera translation initiatio... 21 9.1 >DQ666693-1|ABG29167.1| 250|Apis mellifera MAX dimerization protein protein. Length = 250 Score = 22.2 bits (45), Expect = 5.2 Identities = 8/21 (38%), Positives = 12/21 (57%) Frame = +3 Query: 453 RDIFNRFQRTRRANKKNCKRK 515 R N ++ RRA+ +NC K Sbjct: 50 RTTHNELEKNRRAHLRNCLEK 70 >DQ288391-1|ABC41341.1| 630|Apis mellifera vasa protein protein. Length = 630 Score = 22.2 bits (45), Expect = 5.2 Identities = 14/42 (33%), Positives = 17/42 (40%) Frame = +1 Query: 145 GKTVEAKAWKTTPYDVAKGISQGLADATIIARVNNELWDLDR 270 GKTV K Y G S G II NN+ W + + Sbjct: 6 GKTVSYTNKKDESYFDEGGRSYGKGRGFIIQNNNNDDWSVGK 47 >DQ151547-1|ABA39280.1| 405|Apis mellifera tyramine receptor protein. Length = 405 Score = 22.2 bits (45), Expect = 5.2 Identities = 10/29 (34%), Positives = 14/29 (48%) Frame = -3 Query: 654 VYKWTTPVHSGRRSLNFLI*YPNFERIVI 568 VY+W V SG R PN+ +V+ Sbjct: 12 VYQWNHTVSSGERDTRTEYYLPNWTDLVL 40 >DQ026034-1|AAY87893.1| 569|Apis mellifera nicotinic acetylcholine receptor alpha4subunit protein. Length = 569 Score = 21.4 bits (43), Expect = 9.1 Identities = 7/13 (53%), Positives = 9/13 (69%) Frame = +1 Query: 376 RVYGGCLCYGPPI 414 R G CL +GPP+ Sbjct: 429 RFGGSCLIHGPPL 441 >DQ026033-1|AAY87892.1| 569|Apis mellifera nicotinic acetylcholine receptor alpha4subunit protein. Length = 569 Score = 21.4 bits (43), Expect = 9.1 Identities = 7/13 (53%), Positives = 9/13 (69%) Frame = +1 Query: 376 RVYGGCLCYGPPI 414 R G CL +GPP+ Sbjct: 429 RFGGSCLIHGPPL 441 >AF069739-1|AAC63272.2| 690|Apis mellifera translation initiation factor 2 protein. Length = 690 Score = 21.4 bits (43), Expect = 9.1 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = +1 Query: 448 EKGISSTDFNVLEGLIKKIAKE 513 +KG+S +NV+ LI I KE Sbjct: 551 KKGVSLRFYNVVYKLIDNIKKE 572 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.317 0.135 0.421 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 205,762 Number of Sequences: 438 Number of extensions: 4379 Number of successful extensions: 8 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 22901220 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.6 bits)
- SilkBase 1999-2023 -