BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30706 (577 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY043292-1|AAK96031.1| 323|Tribolium castaneum homeodomain tran... 23 1.9 EF592536-1|ABQ95982.1| 598|Tribolium castaneum beta-N-acetylglu... 22 4.3 AF265213-1|AAF75277.1| 143|Tribolium castaneum putative cytochr... 21 5.7 AY055847-1|AAL23667.2| 312|Tribolium castaneum cephalothorax pr... 21 7.5 AY055846-1|AAL26542.2| 312|Tribolium castaneum cephalothorax pr... 21 7.5 AF426396-1|AAL27023.2| 312|Tribolium castaneum cephalothorax pr... 21 7.5 AF416773-1|AAL09697.1| 268|Tribolium castaneum cephalothorax pr... 21 7.5 AF321227-2|AAK16422.1| 312|Tribolium castaneum Scr protein. 21 7.5 AF264695-1|AAG13009.1| 100|Tribolium castaneum cephalothorax pr... 21 7.5 AF227628-1|AAF42868.1| 312|Tribolium castaneum sex combs reduce... 21 7.5 >AY043292-1|AAK96031.1| 323|Tribolium castaneum homeodomain transcription factor Prothoraxlessprotein. Length = 323 Score = 23.0 bits (47), Expect = 1.9 Identities = 14/38 (36%), Positives = 17/38 (44%) Frame = -3 Query: 224 AREQHPASCRRPASNKTSCGLMPFHVTLYGSPPLGGFP 111 A + P SC + G+ P H YG PP GG P Sbjct: 42 AVQPDPGSCDPSVGLRQ--GIPPHH---YGGPPSGGQP 74 >EF592536-1|ABQ95982.1| 598|Tribolium castaneum beta-N-acetylglucosaminidase NAG1 protein. Length = 598 Score = 21.8 bits (44), Expect = 4.3 Identities = 10/27 (37%), Positives = 12/27 (44%) Frame = -3 Query: 290 SGLSAARAPPHCRSASALWATAAREQH 210 +GLS C A+ALW E H Sbjct: 46 TGLSLPACRLFCSEAAALWPKPTGEVH 72 >AF265213-1|AAF75277.1| 143|Tribolium castaneum putative cytochrome P450 monooxigenaseCYP4Q3 protein. Length = 143 Score = 21.4 bits (43), Expect = 5.7 Identities = 9/18 (50%), Positives = 9/18 (50%) Frame = +2 Query: 500 HPRDITPPPEAMSPRRER 553 H DI P PE P R R Sbjct: 113 HNPDIYPDPEKFDPERFR 130 >AY055847-1|AAL23667.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 21.0 bits (42), Expect = 7.5 Identities = 6/15 (40%), Positives = 11/15 (73%) Frame = -3 Query: 173 SCGLMPFHVTLYGSP 129 S ++P+H++ YG P Sbjct: 283 SMNIVPYHMSPYGHP 297 >AY055846-1|AAL26542.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 21.0 bits (42), Expect = 7.5 Identities = 6/15 (40%), Positives = 11/15 (73%) Frame = -3 Query: 173 SCGLMPFHVTLYGSP 129 S ++P+H++ YG P Sbjct: 283 SMNIVPYHMSPYGHP 297 >AF426396-1|AAL27023.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 21.0 bits (42), Expect = 7.5 Identities = 6/15 (40%), Positives = 11/15 (73%) Frame = -3 Query: 173 SCGLMPFHVTLYGSP 129 S ++P+H++ YG P Sbjct: 283 SMNIVPYHMSPYGHP 297 >AF416773-1|AAL09697.1| 268|Tribolium castaneum cephalothorax protein. Length = 268 Score = 21.0 bits (42), Expect = 7.5 Identities = 6/15 (40%), Positives = 11/15 (73%) Frame = -3 Query: 173 SCGLMPFHVTLYGSP 129 S ++P+H++ YG P Sbjct: 239 SMNIVPYHMSPYGHP 253 >AF321227-2|AAK16422.1| 312|Tribolium castaneum Scr protein. Length = 312 Score = 21.0 bits (42), Expect = 7.5 Identities = 6/15 (40%), Positives = 11/15 (73%) Frame = -3 Query: 173 SCGLMPFHVTLYGSP 129 S ++P+H++ YG P Sbjct: 283 SMNIVPYHMSPYGHP 297 >AF264695-1|AAG13009.1| 100|Tribolium castaneum cephalothorax protein. Length = 100 Score = 21.0 bits (42), Expect = 7.5 Identities = 6/15 (40%), Positives = 11/15 (73%) Frame = -3 Query: 173 SCGLMPFHVTLYGSP 129 S ++P+H++ YG P Sbjct: 71 SMNIVPYHMSPYGHP 85 >AF227628-1|AAF42868.1| 312|Tribolium castaneum sex combs reduced Scr protein. Length = 312 Score = 21.0 bits (42), Expect = 7.5 Identities = 6/15 (40%), Positives = 11/15 (73%) Frame = -3 Query: 173 SCGLMPFHVTLYGSP 129 S ++P+H++ YG P Sbjct: 283 SMNIVPYHMSPYGHP 297 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 113,736 Number of Sequences: 336 Number of extensions: 2159 Number of successful extensions: 10 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 14308417 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -