BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30705 (737 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BT024229-1|ABC86291.1| 1428|Drosophila melanogaster LP01445p pro... 29 5.0 BT003604-1|AAO39607.1| 1191|Drosophila melanogaster GM01778p pro... 29 5.0 AY118859-1|AAM50719.1| 369|Drosophila melanogaster GM23249p pro... 29 5.0 AE014296-1296|AAS65062.1| 872|Drosophila melanogaster CG33275-P... 29 5.0 AE014296-1295|AAS65061.1| 1400|Drosophila melanogaster CG33275-P... 29 5.0 AE014296-1294|AAS65060.1| 1876|Drosophila melanogaster CG33275-P... 29 5.0 X70864-1|CAA50214.1| 1067|Drosophila melanogaster sgg46 protein ... 29 6.6 X70863-1|CAA50213.1| 575|Drosophila melanogaster sgg39 protein ... 29 6.6 X70862-1|CAA50212.1| 514|Drosophila melanogaster sgg protein ki... 29 6.6 X54006-1|CAA37952.1| 733|Drosophila melanogaster protein kinase... 29 6.6 X53332-1|CAA37419.1| 514|Drosophila melanogaster sgg protein ki... 29 6.6 AY122193-1|AAM52705.1| 514|Drosophila melanogaster LD44595p pro... 29 6.6 AY119664-1|AAM50318.1| 496|Drosophila melanogaster SD09379p pro... 29 6.6 AL121804-8|CAB65860.1| 1066|Drosophila melanogaster EG:155E2.3,F... 29 6.6 AL121804-7|CAB72296.1| 514|Drosophila melanogaster EG:155E2.3,F... 29 6.6 AL024485-1|CAA19676.1| 1066|Drosophila melanogaster EG:155E2.3,F... 29 6.6 AF404402-1|AAQ03150.1| 211|Drosophila melanogaster SGG protein. 29 6.6 AF404401-1|AAQ03149.1| 211|Drosophila melanogaster SGG protein. 29 6.6 AF404400-1|AAQ03148.1| 211|Drosophila melanogaster SGG protein. 29 6.6 AF404399-1|AAQ03147.1| 211|Drosophila melanogaster SGG protein. 29 6.6 AF404398-1|AAQ03146.1| 211|Drosophila melanogaster SGG protein. 29 6.6 AF404396-1|AAQ03145.1| 211|Drosophila melanogaster SGG protein. 29 6.6 AF404395-1|AAQ03144.1| 211|Drosophila melanogaster SGG protein. 29 6.6 AF404394-1|AAQ03143.1| 211|Drosophila melanogaster SGG protein. 29 6.6 AF404393-1|AAQ03142.1| 211|Drosophila melanogaster SGG protein. 29 6.6 AF404392-1|AAQ03141.1| 211|Drosophila melanogaster SGG protein. 29 6.6 AF404391-1|AAQ03140.1| 211|Drosophila melanogaster SGG protein. 29 6.6 AF404390-1|AAQ03139.1| 211|Drosophila melanogaster SGG protein. 29 6.6 AF404389-1|AAQ03138.1| 211|Drosophila melanogaster SGG protein. 29 6.6 AF404388-1|AAQ03137.1| 211|Drosophila melanogaster SGG protein. 29 6.6 AF404387-1|AAQ03136.1| 211|Drosophila melanogaster SGG protein. 29 6.6 AF404386-1|AAQ03135.1| 211|Drosophila melanogaster SGG protein. 29 6.6 AF404385-1|AAQ03134.1| 211|Drosophila melanogaster SGG protein. 29 6.6 AF404384-1|AAQ03133.1| 211|Drosophila melanogaster SGG protein. 29 6.6 AF404383-1|AAQ03132.1| 211|Drosophila melanogaster SGG protein. 29 6.6 AF404382-1|AAQ03131.1| 211|Drosophila melanogaster SGG protein. 29 6.6 AF404381-1|AAQ03130.1| 211|Drosophila melanogaster SGG protein. 29 6.6 AF404380-1|AAQ03129.1| 211|Drosophila melanogaster SGG protein. 29 6.6 AF404379-1|AAQ03128.1| 211|Drosophila melanogaster SGG protein. 29 6.6 AF404378-1|AAQ03127.1| 211|Drosophila melanogaster SGG protein. 29 6.6 AF404377-1|AAQ03126.1| 211|Drosophila melanogaster SGG protein. 29 6.6 AF404376-1|AAQ03125.1| 211|Drosophila melanogaster SGG protein. 29 6.6 AF404375-1|AAQ03124.1| 211|Drosophila melanogaster SGG protein. 29 6.6 AF404374-1|AAQ03123.1| 211|Drosophila melanogaster SGG protein. 29 6.6 AF404373-1|AAQ03122.1| 211|Drosophila melanogaster SGG protein. 29 6.6 AF404372-1|AAQ03121.1| 211|Drosophila melanogaster SGG protein. 29 6.6 AF404371-1|AAQ03120.1| 211|Drosophila melanogaster SGG protein. 29 6.6 AF404370-1|AAQ03119.1| 211|Drosophila melanogaster SGG protein. 29 6.6 AF404369-1|AAQ03118.1| 211|Drosophila melanogaster SGG protein. 29 6.6 AF404368-1|AAQ03117.1| 211|Drosophila melanogaster SGG protein. 29 6.6 AF404367-1|AAQ03116.1| 211|Drosophila melanogaster SGG protein. 29 6.6 AF404366-1|AAQ03115.1| 211|Drosophila melanogaster SGG protein. 29 6.6 AF404365-1|AAQ03114.1| 211|Drosophila melanogaster SGG protein. 29 6.6 AF404364-1|AAQ03113.1| 211|Drosophila melanogaster SGG protein. 29 6.6 AF404363-1|AAQ03112.1| 211|Drosophila melanogaster SGG protein. 29 6.6 AF404362-1|AAQ03111.1| 211|Drosophila melanogaster SGG protein. 29 6.6 AF404361-1|AAQ03110.1| 211|Drosophila melanogaster SGG protein. 29 6.6 AF404360-1|AAQ03109.1| 211|Drosophila melanogaster SGG protein. 29 6.6 AF404359-1|AAQ03108.1| 211|Drosophila melanogaster SGG protein. 29 6.6 AF404358-1|AAQ03107.1| 211|Drosophila melanogaster SGG protein. 29 6.6 AF404357-1|AAQ03106.1| 211|Drosophila melanogaster SGG protein. 29 6.6 AF404356-1|AAQ03105.1| 211|Drosophila melanogaster SGG protein. 29 6.6 AF404355-1|AAQ03104.1| 211|Drosophila melanogaster SGG protein. 29 6.6 AF404354-1|AAQ03103.1| 211|Drosophila melanogaster SGG protein. 29 6.6 AF404353-1|AAQ03102.1| 211|Drosophila melanogaster SGG protein. 29 6.6 AF404352-1|AAQ03101.1| 211|Drosophila melanogaster SGG protein. 29 6.6 AF404351-1|AAQ03100.1| 211|Drosophila melanogaster SGG protein. 29 6.6 AF404350-1|AAQ03099.1| 211|Drosophila melanogaster SGG protein. 29 6.6 AF404349-1|AAQ03098.1| 211|Drosophila melanogaster SGG protein. 29 6.6 AE014298-437|AAS65256.1| 416|Drosophila melanogaster CG2621-PK,... 29 6.6 AE014298-436|ABI30966.1| 586|Drosophila melanogaster CG2621-PL,... 29 6.6 AE014298-435|AAF45801.2| 1067|Drosophila melanogaster CG2621-PD,... 29 6.6 AE014298-434|AAS65255.1| 496|Drosophila melanogaster CG2621-PG,... 29 6.6 AE014298-433|AAS65254.1| 514|Drosophila melanogaster CG2621-PI,... 29 6.6 AE014298-432|AAS65253.1| 514|Drosophila melanogaster CG2621-PH,... 29 6.6 AE014298-431|AAN09086.1| 514|Drosophila melanogaster CG2621-PF,... 29 6.6 AE014298-430|AAN09085.1| 514|Drosophila melanogaster CG2621-PE,... 29 6.6 AE014298-429|AAN09084.1| 514|Drosophila melanogaster CG2621-PC,... 29 6.6 AE014298-428|AAN09083.1| 514|Drosophila melanogaster CG2621-PB,... 29 6.6 AE014298-427|AAS65252.1| 575|Drosophila melanogaster CG2621-PJ,... 29 6.6 AE014298-426|AAN09082.1| 575|Drosophila melanogaster CG2621-PA,... 29 6.6 >BT024229-1|ABC86291.1| 1428|Drosophila melanogaster LP01445p protein. Length = 1428 Score = 29.5 bits (63), Expect = 5.0 Identities = 16/69 (23%), Positives = 36/69 (52%), Gaps = 1/69 (1%) Frame = +2 Query: 128 RPKKTWM-ECVNDDMRERERGVSAEMTADRRELNRKIRCADPT*DKVEKK*KSDIEPVRS 304 +P TWM +C+++D++ +++ + + NR++R A+ + + K DI P + Sbjct: 1153 KPDDTWMLQCMSEDIKNAWTEEISKLLWKQAKRNREVRLAEMSSMGIGSKPCLDIRPSNN 1212 Query: 305 YFERKSVIL 331 +S+ L Sbjct: 1213 QISDRSIPL 1221 >BT003604-1|AAO39607.1| 1191|Drosophila melanogaster GM01778p protein. Length = 1191 Score = 29.5 bits (63), Expect = 5.0 Identities = 16/69 (23%), Positives = 36/69 (52%), Gaps = 1/69 (1%) Frame = +2 Query: 128 RPKKTWM-ECVNDDMRERERGVSAEMTADRRELNRKIRCADPT*DKVEKK*KSDIEPVRS 304 +P TWM +C+++D++ +++ + + NR++R A+ + + K DI P + Sbjct: 916 KPDDTWMLQCMSEDIKNAWTEEISKLLWKQAKRNREVRLAEMSSMGIGSKPCLDIRPSNN 975 Query: 305 YFERKSVIL 331 +S+ L Sbjct: 976 QISDRSIPL 984 >AY118859-1|AAM50719.1| 369|Drosophila melanogaster GM23249p protein. Length = 369 Score = 29.5 bits (63), Expect = 5.0 Identities = 16/69 (23%), Positives = 36/69 (52%), Gaps = 1/69 (1%) Frame = +2 Query: 128 RPKKTWM-ECVNDDMRERERGVSAEMTADRRELNRKIRCADPT*DKVEKK*KSDIEPVRS 304 +P TWM +C+++D++ +++ + + NR++R A+ + + K DI P + Sbjct: 94 KPDDTWMLQCMSEDIKNAWTEEISKLLWKQAKRNREVRLAEMSSMGIGSKPCLDIRPSNN 153 Query: 305 YFERKSVIL 331 +S+ L Sbjct: 154 QISDRSIPL 162 >AE014296-1296|AAS65062.1| 872|Drosophila melanogaster CG33275-PC, isoform C protein. Length = 872 Score = 29.5 bits (63), Expect = 5.0 Identities = 16/69 (23%), Positives = 36/69 (52%), Gaps = 1/69 (1%) Frame = +2 Query: 128 RPKKTWM-ECVNDDMRERERGVSAEMTADRRELNRKIRCADPT*DKVEKK*KSDIEPVRS 304 +P TWM +C+++D++ +++ + + NR++R A+ + + K DI P + Sbjct: 597 KPDDTWMLQCMSEDIKNAWTEEISKLLWKQAKRNREVRLAEMSSMGIGSKPCLDIRPSNN 656 Query: 305 YFERKSVIL 331 +S+ L Sbjct: 657 QISDRSIPL 665 >AE014296-1295|AAS65061.1| 1400|Drosophila melanogaster CG33275-PB, isoform B protein. Length = 1400 Score = 29.5 bits (63), Expect = 5.0 Identities = 16/69 (23%), Positives = 36/69 (52%), Gaps = 1/69 (1%) Frame = +2 Query: 128 RPKKTWM-ECVNDDMRERERGVSAEMTADRRELNRKIRCADPT*DKVEKK*KSDIEPVRS 304 +P TWM +C+++D++ +++ + + NR++R A+ + + K DI P + Sbjct: 1125 KPDDTWMLQCMSEDIKNAWTEEISKLLWKQAKRNREVRLAEMSSMGIGSKPCLDIRPSNN 1184 Query: 305 YFERKSVIL 331 +S+ L Sbjct: 1185 QISDRSIPL 1193 >AE014296-1294|AAS65060.1| 1876|Drosophila melanogaster CG33275-PA, isoform A protein. Length = 1876 Score = 29.5 bits (63), Expect = 5.0 Identities = 16/69 (23%), Positives = 36/69 (52%), Gaps = 1/69 (1%) Frame = +2 Query: 128 RPKKTWM-ECVNDDMRERERGVSAEMTADRRELNRKIRCADPT*DKVEKK*KSDIEPVRS 304 +P TWM +C+++D++ +++ + + NR++R A+ + + K DI P + Sbjct: 1601 KPDDTWMLQCMSEDIKNAWTEEISKLLWKQAKRNREVRLAEMSSMGIGSKPCLDIRPSNN 1660 Query: 305 YFERKSVIL 331 +S+ L Sbjct: 1661 QISDRSIPL 1669 >X70864-1|CAA50214.1| 1067|Drosophila melanogaster sgg46 protein kinase protein. Length = 1067 Score = 29.1 bits (62), Expect = 6.6 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = +1 Query: 349 GNHTIHLGRDLPLLYLFCHH 408 GNHT+ GRD+P L+ F H Sbjct: 898 GNHTLPNGRDMPPLFNFTEH 917 >X70863-1|CAA50213.1| 575|Drosophila melanogaster sgg39 protein kinase protein. Length = 575 Score = 29.1 bits (62), Expect = 6.6 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = +1 Query: 349 GNHTIHLGRDLPLLYLFCHH 408 GNHT+ GRD+P L+ F H Sbjct: 345 GNHTLPNGRDMPPLFNFTEH 364 >X70862-1|CAA50212.1| 514|Drosophila melanogaster sgg protein kinase protein. Length = 514 Score = 29.1 bits (62), Expect = 6.6 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = +1 Query: 349 GNHTIHLGRDLPLLYLFCHH 408 GNHT+ GRD+P L+ F H Sbjct: 345 GNHTLPNGRDMPPLFNFTEH 364 >X54006-1|CAA37952.1| 733|Drosophila melanogaster protein kinase protein. Length = 733 Score = 29.1 bits (62), Expect = 6.6 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = +1 Query: 349 GNHTIHLGRDLPLLYLFCHH 408 GNHT+ GRD+P L+ F H Sbjct: 578 GNHTLPNGRDMPPLFNFTEH 597 >X53332-1|CAA37419.1| 514|Drosophila melanogaster sgg protein kinase protein. Length = 514 Score = 29.1 bits (62), Expect = 6.6 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = +1 Query: 349 GNHTIHLGRDLPLLYLFCHH 408 GNHT+ GRD+P L+ F H Sbjct: 345 GNHTLPNGRDMPPLFNFTEH 364 >AY122193-1|AAM52705.1| 514|Drosophila melanogaster LD44595p protein. Length = 514 Score = 29.1 bits (62), Expect = 6.6 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = +1 Query: 349 GNHTIHLGRDLPLLYLFCHH 408 GNHT+ GRD+P L+ F H Sbjct: 345 GNHTLPNGRDMPPLFNFTEH 364 >AY119664-1|AAM50318.1| 496|Drosophila melanogaster SD09379p protein. Length = 496 Score = 29.1 bits (62), Expect = 6.6 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = +1 Query: 349 GNHTIHLGRDLPLLYLFCHH 408 GNHT+ GRD+P L+ F H Sbjct: 327 GNHTLPNGRDMPPLFNFTEH 346 >AL121804-8|CAB65860.1| 1066|Drosophila melanogaster EG:155E2.3,FBgn0003371;sgg protein. Length = 1066 Score = 29.1 bits (62), Expect = 6.6 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = +1 Query: 349 GNHTIHLGRDLPLLYLFCHH 408 GNHT+ GRD+P L+ F H Sbjct: 897 GNHTLPNGRDMPPLFNFTEH 916 >AL121804-7|CAB72296.1| 514|Drosophila melanogaster EG:155E2.3,FBgn0003371;sgg protein. Length = 514 Score = 29.1 bits (62), Expect = 6.6 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = +1 Query: 349 GNHTIHLGRDLPLLYLFCHH 408 GNHT+ GRD+P L+ F H Sbjct: 345 GNHTLPNGRDMPPLFNFTEH 364 >AL024485-1|CAA19676.1| 1066|Drosophila melanogaster EG:155E2.3,FBgn0003371;sgg protein. Length = 1066 Score = 29.1 bits (62), Expect = 6.6 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = +1 Query: 349 GNHTIHLGRDLPLLYLFCHH 408 GNHT+ GRD+P L+ F H Sbjct: 897 GNHTLPNGRDMPPLFNFTEH 916 >AF404402-1|AAQ03150.1| 211|Drosophila melanogaster SGG protein. Length = 211 Score = 29.1 bits (62), Expect = 6.6 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = +1 Query: 349 GNHTIHLGRDLPLLYLFCHH 408 GNHT+ GRD+P L+ F H Sbjct: 44 GNHTLPNGRDMPPLFNFTEH 63 >AF404401-1|AAQ03149.1| 211|Drosophila melanogaster SGG protein. Length = 211 Score = 29.1 bits (62), Expect = 6.6 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = +1 Query: 349 GNHTIHLGRDLPLLYLFCHH 408 GNHT+ GRD+P L+ F H Sbjct: 44 GNHTLPNGRDMPPLFNFTEH 63 >AF404400-1|AAQ03148.1| 211|Drosophila melanogaster SGG protein. Length = 211 Score = 29.1 bits (62), Expect = 6.6 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = +1 Query: 349 GNHTIHLGRDLPLLYLFCHH 408 GNHT+ GRD+P L+ F H Sbjct: 44 GNHTLPNGRDMPPLFNFTEH 63 >AF404399-1|AAQ03147.1| 211|Drosophila melanogaster SGG protein. Length = 211 Score = 29.1 bits (62), Expect = 6.6 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = +1 Query: 349 GNHTIHLGRDLPLLYLFCHH 408 GNHT+ GRD+P L+ F H Sbjct: 44 GNHTLPNGRDMPPLFNFTEH 63 >AF404398-1|AAQ03146.1| 211|Drosophila melanogaster SGG protein. Length = 211 Score = 29.1 bits (62), Expect = 6.6 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = +1 Query: 349 GNHTIHLGRDLPLLYLFCHH 408 GNHT+ GRD+P L+ F H Sbjct: 44 GNHTLPNGRDMPPLFNFTEH 63 >AF404396-1|AAQ03145.1| 211|Drosophila melanogaster SGG protein. Length = 211 Score = 29.1 bits (62), Expect = 6.6 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = +1 Query: 349 GNHTIHLGRDLPLLYLFCHH 408 GNHT+ GRD+P L+ F H Sbjct: 44 GNHTLPNGRDMPPLFNFTEH 63 >AF404395-1|AAQ03144.1| 211|Drosophila melanogaster SGG protein. Length = 211 Score = 29.1 bits (62), Expect = 6.6 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = +1 Query: 349 GNHTIHLGRDLPLLYLFCHH 408 GNHT+ GRD+P L+ F H Sbjct: 44 GNHTLPNGRDMPPLFNFTEH 63 >AF404394-1|AAQ03143.1| 211|Drosophila melanogaster SGG protein. Length = 211 Score = 29.1 bits (62), Expect = 6.6 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = +1 Query: 349 GNHTIHLGRDLPLLYLFCHH 408 GNHT+ GRD+P L+ F H Sbjct: 44 GNHTLPNGRDMPPLFNFTEH 63 >AF404393-1|AAQ03142.1| 211|Drosophila melanogaster SGG protein. Length = 211 Score = 29.1 bits (62), Expect = 6.6 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = +1 Query: 349 GNHTIHLGRDLPLLYLFCHH 408 GNHT+ GRD+P L+ F H Sbjct: 44 GNHTLPNGRDMPPLFNFTEH 63 >AF404392-1|AAQ03141.1| 211|Drosophila melanogaster SGG protein. Length = 211 Score = 29.1 bits (62), Expect = 6.6 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = +1 Query: 349 GNHTIHLGRDLPLLYLFCHH 408 GNHT+ GRD+P L+ F H Sbjct: 44 GNHTLPNGRDMPPLFNFTEH 63 >AF404391-1|AAQ03140.1| 211|Drosophila melanogaster SGG protein. Length = 211 Score = 29.1 bits (62), Expect = 6.6 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = +1 Query: 349 GNHTIHLGRDLPLLYLFCHH 408 GNHT+ GRD+P L+ F H Sbjct: 44 GNHTLPNGRDMPPLFNFTEH 63 >AF404390-1|AAQ03139.1| 211|Drosophila melanogaster SGG protein. Length = 211 Score = 29.1 bits (62), Expect = 6.6 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = +1 Query: 349 GNHTIHLGRDLPLLYLFCHH 408 GNHT+ GRD+P L+ F H Sbjct: 44 GNHTLPNGRDMPPLFNFTEH 63 >AF404389-1|AAQ03138.1| 211|Drosophila melanogaster SGG protein. Length = 211 Score = 29.1 bits (62), Expect = 6.6 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = +1 Query: 349 GNHTIHLGRDLPLLYLFCHH 408 GNHT+ GRD+P L+ F H Sbjct: 44 GNHTLPNGRDMPPLFNFTEH 63 >AF404388-1|AAQ03137.1| 211|Drosophila melanogaster SGG protein. Length = 211 Score = 29.1 bits (62), Expect = 6.6 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = +1 Query: 349 GNHTIHLGRDLPLLYLFCHH 408 GNHT+ GRD+P L+ F H Sbjct: 44 GNHTLPNGRDMPPLFNFTEH 63 >AF404387-1|AAQ03136.1| 211|Drosophila melanogaster SGG protein. Length = 211 Score = 29.1 bits (62), Expect = 6.6 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = +1 Query: 349 GNHTIHLGRDLPLLYLFCHH 408 GNHT+ GRD+P L+ F H Sbjct: 44 GNHTLPNGRDMPPLFNFTEH 63 >AF404386-1|AAQ03135.1| 211|Drosophila melanogaster SGG protein. Length = 211 Score = 29.1 bits (62), Expect = 6.6 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = +1 Query: 349 GNHTIHLGRDLPLLYLFCHH 408 GNHT+ GRD+P L+ F H Sbjct: 44 GNHTLPNGRDMPPLFNFTEH 63 >AF404385-1|AAQ03134.1| 211|Drosophila melanogaster SGG protein. Length = 211 Score = 29.1 bits (62), Expect = 6.6 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = +1 Query: 349 GNHTIHLGRDLPLLYLFCHH 408 GNHT+ GRD+P L+ F H Sbjct: 44 GNHTLPNGRDMPPLFNFTEH 63 >AF404384-1|AAQ03133.1| 211|Drosophila melanogaster SGG protein. Length = 211 Score = 29.1 bits (62), Expect = 6.6 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = +1 Query: 349 GNHTIHLGRDLPLLYLFCHH 408 GNHT+ GRD+P L+ F H Sbjct: 44 GNHTLPNGRDMPPLFNFTEH 63 >AF404383-1|AAQ03132.1| 211|Drosophila melanogaster SGG protein. Length = 211 Score = 29.1 bits (62), Expect = 6.6 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = +1 Query: 349 GNHTIHLGRDLPLLYLFCHH 408 GNHT+ GRD+P L+ F H Sbjct: 44 GNHTLPNGRDMPPLFNFTEH 63 >AF404382-1|AAQ03131.1| 211|Drosophila melanogaster SGG protein. Length = 211 Score = 29.1 bits (62), Expect = 6.6 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = +1 Query: 349 GNHTIHLGRDLPLLYLFCHH 408 GNHT+ GRD+P L+ F H Sbjct: 44 GNHTLPNGRDMPPLFNFTEH 63 >AF404381-1|AAQ03130.1| 211|Drosophila melanogaster SGG protein. Length = 211 Score = 29.1 bits (62), Expect = 6.6 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = +1 Query: 349 GNHTIHLGRDLPLLYLFCHH 408 GNHT+ GRD+P L+ F H Sbjct: 44 GNHTLPNGRDMPPLFNFTEH 63 >AF404380-1|AAQ03129.1| 211|Drosophila melanogaster SGG protein. Length = 211 Score = 29.1 bits (62), Expect = 6.6 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = +1 Query: 349 GNHTIHLGRDLPLLYLFCHH 408 GNHT+ GRD+P L+ F H Sbjct: 44 GNHTLPNGRDMPPLFNFTEH 63 >AF404379-1|AAQ03128.1| 211|Drosophila melanogaster SGG protein. Length = 211 Score = 29.1 bits (62), Expect = 6.6 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = +1 Query: 349 GNHTIHLGRDLPLLYLFCHH 408 GNHT+ GRD+P L+ F H Sbjct: 44 GNHTLPNGRDMPPLFNFTEH 63 >AF404378-1|AAQ03127.1| 211|Drosophila melanogaster SGG protein. Length = 211 Score = 29.1 bits (62), Expect = 6.6 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = +1 Query: 349 GNHTIHLGRDLPLLYLFCHH 408 GNHT+ GRD+P L+ F H Sbjct: 44 GNHTLPNGRDMPPLFNFTEH 63 >AF404377-1|AAQ03126.1| 211|Drosophila melanogaster SGG protein. Length = 211 Score = 29.1 bits (62), Expect = 6.6 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = +1 Query: 349 GNHTIHLGRDLPLLYLFCHH 408 GNHT+ GRD+P L+ F H Sbjct: 44 GNHTLPNGRDMPPLFNFTEH 63 >AF404376-1|AAQ03125.1| 211|Drosophila melanogaster SGG protein. Length = 211 Score = 29.1 bits (62), Expect = 6.6 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = +1 Query: 349 GNHTIHLGRDLPLLYLFCHH 408 GNHT+ GRD+P L+ F H Sbjct: 44 GNHTLPNGRDMPPLFNFTEH 63 >AF404375-1|AAQ03124.1| 211|Drosophila melanogaster SGG protein. Length = 211 Score = 29.1 bits (62), Expect = 6.6 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = +1 Query: 349 GNHTIHLGRDLPLLYLFCHH 408 GNHT+ GRD+P L+ F H Sbjct: 44 GNHTLPNGRDMPPLFNFTEH 63 >AF404374-1|AAQ03123.1| 211|Drosophila melanogaster SGG protein. Length = 211 Score = 29.1 bits (62), Expect = 6.6 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = +1 Query: 349 GNHTIHLGRDLPLLYLFCHH 408 GNHT+ GRD+P L+ F H Sbjct: 44 GNHTLPNGRDMPPLFNFTEH 63 >AF404373-1|AAQ03122.1| 211|Drosophila melanogaster SGG protein. Length = 211 Score = 29.1 bits (62), Expect = 6.6 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = +1 Query: 349 GNHTIHLGRDLPLLYLFCHH 408 GNHT+ GRD+P L+ F H Sbjct: 44 GNHTLPNGRDMPPLFNFTEH 63 >AF404372-1|AAQ03121.1| 211|Drosophila melanogaster SGG protein. Length = 211 Score = 29.1 bits (62), Expect = 6.6 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = +1 Query: 349 GNHTIHLGRDLPLLYLFCHH 408 GNHT+ GRD+P L+ F H Sbjct: 44 GNHTLPNGRDMPPLFNFTEH 63 >AF404371-1|AAQ03120.1| 211|Drosophila melanogaster SGG protein. Length = 211 Score = 29.1 bits (62), Expect = 6.6 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = +1 Query: 349 GNHTIHLGRDLPLLYLFCHH 408 GNHT+ GRD+P L+ F H Sbjct: 44 GNHTLPNGRDMPPLFNFTEH 63 >AF404370-1|AAQ03119.1| 211|Drosophila melanogaster SGG protein. Length = 211 Score = 29.1 bits (62), Expect = 6.6 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = +1 Query: 349 GNHTIHLGRDLPLLYLFCHH 408 GNHT+ GRD+P L+ F H Sbjct: 44 GNHTLPNGRDMPPLFNFTEH 63 >AF404369-1|AAQ03118.1| 211|Drosophila melanogaster SGG protein. Length = 211 Score = 29.1 bits (62), Expect = 6.6 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = +1 Query: 349 GNHTIHLGRDLPLLYLFCHH 408 GNHT+ GRD+P L+ F H Sbjct: 44 GNHTLPNGRDMPPLFNFTEH 63 >AF404368-1|AAQ03117.1| 211|Drosophila melanogaster SGG protein. Length = 211 Score = 29.1 bits (62), Expect = 6.6 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = +1 Query: 349 GNHTIHLGRDLPLLYLFCHH 408 GNHT+ GRD+P L+ F H Sbjct: 44 GNHTLPNGRDMPPLFNFTEH 63 >AF404367-1|AAQ03116.1| 211|Drosophila melanogaster SGG protein. Length = 211 Score = 29.1 bits (62), Expect = 6.6 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = +1 Query: 349 GNHTIHLGRDLPLLYLFCHH 408 GNHT+ GRD+P L+ F H Sbjct: 44 GNHTLPNGRDMPPLFNFTEH 63 >AF404366-1|AAQ03115.1| 211|Drosophila melanogaster SGG protein. Length = 211 Score = 29.1 bits (62), Expect = 6.6 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = +1 Query: 349 GNHTIHLGRDLPLLYLFCHH 408 GNHT+ GRD+P L+ F H Sbjct: 44 GNHTLPNGRDMPPLFNFTEH 63 >AF404365-1|AAQ03114.1| 211|Drosophila melanogaster SGG protein. Length = 211 Score = 29.1 bits (62), Expect = 6.6 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = +1 Query: 349 GNHTIHLGRDLPLLYLFCHH 408 GNHT+ GRD+P L+ F H Sbjct: 44 GNHTLPNGRDMPPLFNFTEH 63 >AF404364-1|AAQ03113.1| 211|Drosophila melanogaster SGG protein. Length = 211 Score = 29.1 bits (62), Expect = 6.6 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = +1 Query: 349 GNHTIHLGRDLPLLYLFCHH 408 GNHT+ GRD+P L+ F H Sbjct: 44 GNHTLPNGRDMPPLFNFTEH 63 >AF404363-1|AAQ03112.1| 211|Drosophila melanogaster SGG protein. Length = 211 Score = 29.1 bits (62), Expect = 6.6 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = +1 Query: 349 GNHTIHLGRDLPLLYLFCHH 408 GNHT+ GRD+P L+ F H Sbjct: 44 GNHTLPNGRDMPPLFNFTEH 63 >AF404362-1|AAQ03111.1| 211|Drosophila melanogaster SGG protein. Length = 211 Score = 29.1 bits (62), Expect = 6.6 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = +1 Query: 349 GNHTIHLGRDLPLLYLFCHH 408 GNHT+ GRD+P L+ F H Sbjct: 44 GNHTLPNGRDMPPLFNFTEH 63 >AF404361-1|AAQ03110.1| 211|Drosophila melanogaster SGG protein. Length = 211 Score = 29.1 bits (62), Expect = 6.6 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = +1 Query: 349 GNHTIHLGRDLPLLYLFCHH 408 GNHT+ GRD+P L+ F H Sbjct: 44 GNHTLPNGRDMPPLFNFTEH 63 >AF404360-1|AAQ03109.1| 211|Drosophila melanogaster SGG protein. Length = 211 Score = 29.1 bits (62), Expect = 6.6 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = +1 Query: 349 GNHTIHLGRDLPLLYLFCHH 408 GNHT+ GRD+P L+ F H Sbjct: 44 GNHTLPNGRDMPPLFNFTEH 63 >AF404359-1|AAQ03108.1| 211|Drosophila melanogaster SGG protein. Length = 211 Score = 29.1 bits (62), Expect = 6.6 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = +1 Query: 349 GNHTIHLGRDLPLLYLFCHH 408 GNHT+ GRD+P L+ F H Sbjct: 44 GNHTLPNGRDMPPLFNFTEH 63 >AF404358-1|AAQ03107.1| 211|Drosophila melanogaster SGG protein. Length = 211 Score = 29.1 bits (62), Expect = 6.6 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = +1 Query: 349 GNHTIHLGRDLPLLYLFCHH 408 GNHT+ GRD+P L+ F H Sbjct: 44 GNHTLPNGRDMPPLFNFTEH 63 >AF404357-1|AAQ03106.1| 211|Drosophila melanogaster SGG protein. Length = 211 Score = 29.1 bits (62), Expect = 6.6 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = +1 Query: 349 GNHTIHLGRDLPLLYLFCHH 408 GNHT+ GRD+P L+ F H Sbjct: 44 GNHTLPNGRDMPPLFNFTEH 63 >AF404356-1|AAQ03105.1| 211|Drosophila melanogaster SGG protein. Length = 211 Score = 29.1 bits (62), Expect = 6.6 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = +1 Query: 349 GNHTIHLGRDLPLLYLFCHH 408 GNHT+ GRD+P L+ F H Sbjct: 44 GNHTLPNGRDMPPLFNFTEH 63 >AF404355-1|AAQ03104.1| 211|Drosophila melanogaster SGG protein. Length = 211 Score = 29.1 bits (62), Expect = 6.6 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = +1 Query: 349 GNHTIHLGRDLPLLYLFCHH 408 GNHT+ GRD+P L+ F H Sbjct: 44 GNHTLPNGRDMPPLFNFTEH 63 >AF404354-1|AAQ03103.1| 211|Drosophila melanogaster SGG protein. Length = 211 Score = 29.1 bits (62), Expect = 6.6 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = +1 Query: 349 GNHTIHLGRDLPLLYLFCHH 408 GNHT+ GRD+P L+ F H Sbjct: 44 GNHTLPNGRDMPPLFNFTEH 63 >AF404353-1|AAQ03102.1| 211|Drosophila melanogaster SGG protein. Length = 211 Score = 29.1 bits (62), Expect = 6.6 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = +1 Query: 349 GNHTIHLGRDLPLLYLFCHH 408 GNHT+ GRD+P L+ F H Sbjct: 44 GNHTLPNGRDMPPLFNFTEH 63 >AF404352-1|AAQ03101.1| 211|Drosophila melanogaster SGG protein. Length = 211 Score = 29.1 bits (62), Expect = 6.6 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = +1 Query: 349 GNHTIHLGRDLPLLYLFCHH 408 GNHT+ GRD+P L+ F H Sbjct: 44 GNHTLPNGRDMPPLFNFTEH 63 >AF404351-1|AAQ03100.1| 211|Drosophila melanogaster SGG protein. Length = 211 Score = 29.1 bits (62), Expect = 6.6 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = +1 Query: 349 GNHTIHLGRDLPLLYLFCHH 408 GNHT+ GRD+P L+ F H Sbjct: 44 GNHTLPNGRDMPPLFNFTEH 63 >AF404350-1|AAQ03099.1| 211|Drosophila melanogaster SGG protein. Length = 211 Score = 29.1 bits (62), Expect = 6.6 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = +1 Query: 349 GNHTIHLGRDLPLLYLFCHH 408 GNHT+ GRD+P L+ F H Sbjct: 44 GNHTLPNGRDMPPLFNFTEH 63 >AF404349-1|AAQ03098.1| 211|Drosophila melanogaster SGG protein. Length = 211 Score = 29.1 bits (62), Expect = 6.6 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = +1 Query: 349 GNHTIHLGRDLPLLYLFCHH 408 GNHT+ GRD+P L+ F H Sbjct: 44 GNHTLPNGRDMPPLFNFTEH 63 >AE014298-437|AAS65256.1| 416|Drosophila melanogaster CG2621-PK, isoform K protein. Length = 416 Score = 29.1 bits (62), Expect = 6.6 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = +1 Query: 349 GNHTIHLGRDLPLLYLFCHH 408 GNHT+ GRD+P L+ F H Sbjct: 247 GNHTLPNGRDMPPLFNFTEH 266 >AE014298-436|ABI30966.1| 586|Drosophila melanogaster CG2621-PL, isoform L protein. Length = 586 Score = 29.1 bits (62), Expect = 6.6 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = +1 Query: 349 GNHTIHLGRDLPLLYLFCHH 408 GNHT+ GRD+P L+ F H Sbjct: 356 GNHTLPNGRDMPPLFNFTEH 375 >AE014298-435|AAF45801.2| 1067|Drosophila melanogaster CG2621-PD, isoform D protein. Length = 1067 Score = 29.1 bits (62), Expect = 6.6 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = +1 Query: 349 GNHTIHLGRDLPLLYLFCHH 408 GNHT+ GRD+P L+ F H Sbjct: 898 GNHTLPNGRDMPPLFNFTEH 917 >AE014298-434|AAS65255.1| 496|Drosophila melanogaster CG2621-PG, isoform G protein. Length = 496 Score = 29.1 bits (62), Expect = 6.6 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = +1 Query: 349 GNHTIHLGRDLPLLYLFCHH 408 GNHT+ GRD+P L+ F H Sbjct: 327 GNHTLPNGRDMPPLFNFTEH 346 >AE014298-433|AAS65254.1| 514|Drosophila melanogaster CG2621-PI, isoform I protein. Length = 514 Score = 29.1 bits (62), Expect = 6.6 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = +1 Query: 349 GNHTIHLGRDLPLLYLFCHH 408 GNHT+ GRD+P L+ F H Sbjct: 345 GNHTLPNGRDMPPLFNFTEH 364 >AE014298-432|AAS65253.1| 514|Drosophila melanogaster CG2621-PH, isoform H protein. Length = 514 Score = 29.1 bits (62), Expect = 6.6 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = +1 Query: 349 GNHTIHLGRDLPLLYLFCHH 408 GNHT+ GRD+P L+ F H Sbjct: 345 GNHTLPNGRDMPPLFNFTEH 364 >AE014298-431|AAN09086.1| 514|Drosophila melanogaster CG2621-PF, isoform F protein. Length = 514 Score = 29.1 bits (62), Expect = 6.6 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = +1 Query: 349 GNHTIHLGRDLPLLYLFCHH 408 GNHT+ GRD+P L+ F H Sbjct: 345 GNHTLPNGRDMPPLFNFTEH 364 >AE014298-430|AAN09085.1| 514|Drosophila melanogaster CG2621-PE, isoform E protein. Length = 514 Score = 29.1 bits (62), Expect = 6.6 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = +1 Query: 349 GNHTIHLGRDLPLLYLFCHH 408 GNHT+ GRD+P L+ F H Sbjct: 345 GNHTLPNGRDMPPLFNFTEH 364 >AE014298-429|AAN09084.1| 514|Drosophila melanogaster CG2621-PC, isoform C protein. Length = 514 Score = 29.1 bits (62), Expect = 6.6 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = +1 Query: 349 GNHTIHLGRDLPLLYLFCHH 408 GNHT+ GRD+P L+ F H Sbjct: 345 GNHTLPNGRDMPPLFNFTEH 364 >AE014298-428|AAN09083.1| 514|Drosophila melanogaster CG2621-PB, isoform B protein. Length = 514 Score = 29.1 bits (62), Expect = 6.6 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = +1 Query: 349 GNHTIHLGRDLPLLYLFCHH 408 GNHT+ GRD+P L+ F H Sbjct: 345 GNHTLPNGRDMPPLFNFTEH 364 >AE014298-427|AAS65252.1| 575|Drosophila melanogaster CG2621-PJ, isoform J protein. Length = 575 Score = 29.1 bits (62), Expect = 6.6 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = +1 Query: 349 GNHTIHLGRDLPLLYLFCHH 408 GNHT+ GRD+P L+ F H Sbjct: 345 GNHTLPNGRDMPPLFNFTEH 364 >AE014298-426|AAN09082.1| 575|Drosophila melanogaster CG2621-PA, isoform A protein. Length = 575 Score = 29.1 bits (62), Expect = 6.6 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = +1 Query: 349 GNHTIHLGRDLPLLYLFCHH 408 GNHT+ GRD+P L+ F H Sbjct: 345 GNHTLPNGRDMPPLFNFTEH 364 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 29,357,440 Number of Sequences: 53049 Number of extensions: 583819 Number of successful extensions: 1793 Number of sequences better than 10.0: 81 Number of HSP's better than 10.0 without gapping: 1746 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1793 length of database: 24,988,368 effective HSP length: 83 effective length of database: 20,585,301 effective search space used: 3334818762 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -