BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30702 (804 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC1259.08 |||conserved fungal protein|Schizosaccharomyces pomb... 27 3.1 SPAC15E1.04 |||thymidylate synthase |Schizosaccharomyces pombe|c... 26 7.2 >SPCC1259.08 |||conserved fungal protein|Schizosaccharomyces pombe|chr 3|||Manual Length = 394 Score = 27.1 bits (57), Expect = 3.1 Identities = 17/53 (32%), Positives = 32/53 (60%), Gaps = 2/53 (3%) Frame = +2 Query: 290 YSQTPAGPS*GRGTVTLAVLQPGPPGDMSALHA-GTRRWARVKLHARRPQ-VH 442 + Q+P + +G VT AVL P +++++ A G+R+ + + +AR+ Q VH Sbjct: 44 HEQSPRMSTVSQGRVTFAVLPTKPKDEVTSMKANGSRQSSCIVSNARKRQSVH 96 >SPAC15E1.04 |||thymidylate synthase |Schizosaccharomyces pombe|chr 1|||Manual Length = 625 Score = 25.8 bits (54), Expect = 7.2 Identities = 10/21 (47%), Positives = 14/21 (66%) Frame = +1 Query: 439 TRHTNRGSDSLTDIACTLRLN 501 T +TN+G D L + TL+LN Sbjct: 453 TDYTNKGVDQLAQVISTLKLN 473 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,406,747 Number of Sequences: 5004 Number of extensions: 71196 Number of successful extensions: 173 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 170 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 173 length of database: 2,362,478 effective HSP length: 72 effective length of database: 2,002,190 effective search space used: 390427050 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -