BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30697 (342 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecul... 25 0.25 AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member A... 25 0.25 AF004169-1|AAC13418.1| 371|Apis mellifera ultraviolet-sensitive... 22 1.8 AB022908-1|BAA86909.1| 493|Apis mellifera amylase protein. 21 4.1 DQ069332-1|AAZ32217.1| 296|Apis mellifera RNA polymerase II lar... 20 9.5 AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter... 20 9.5 AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter... 20 9.5 >AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecule AbsCAM-Ig7B protein. Length = 1923 Score = 25.0 bits (52), Expect = 0.25 Identities = 14/35 (40%), Positives = 17/35 (48%) Frame = -1 Query: 108 SPGIPPLEWFLTKFVTTFLPNLFEMRVNGVIIFTF 4 +PGIPP FL+ TT + L NG I F Sbjct: 1498 APGIPPAATFLSPNSTTLVLRLHVWPDNGCPILYF 1532 >AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member AbsCAM-Ig7A protein. Length = 1919 Score = 25.0 bits (52), Expect = 0.25 Identities = 14/35 (40%), Positives = 17/35 (48%) Frame = -1 Query: 108 SPGIPPLEWFLTKFVTTFLPNLFEMRVNGVIIFTF 4 +PGIPP FL+ TT + L NG I F Sbjct: 1494 APGIPPAATFLSPNSTTLVLRLHVWPDNGCPILYF 1528 >AF004169-1|AAC13418.1| 371|Apis mellifera ultraviolet-sensitive opsin protein. Length = 371 Score = 22.2 bits (45), Expect = 1.8 Identities = 15/38 (39%), Positives = 19/38 (50%) Frame = -1 Query: 117 GRFSPGIPPLEWFLTKFVTTFLPNLFEMRVNGVIIFTF 4 GRF P E FLT +L + E+R+ IFTF Sbjct: 186 GRFVP-----EGFLTSCSFDYLTDTNEIRIFVATIFTF 218 >AB022908-1|BAA86909.1| 493|Apis mellifera amylase protein. Length = 493 Score = 21.0 bits (42), Expect = 4.1 Identities = 10/31 (32%), Positives = 15/31 (48%) Frame = +2 Query: 71 FVRNHSNGGIPGENLPFDIHNRYKLTLYFIL 163 FV NH + L + RYK+ + F+L Sbjct: 304 FVDNHDTQRDNPQILTYKYSKRYKMAVAFML 334 >DQ069332-1|AAZ32217.1| 296|Apis mellifera RNA polymerase II large subunit protein. Length = 296 Score = 19.8 bits (39), Expect = 9.5 Identities = 6/10 (60%), Positives = 8/10 (80%) Frame = -2 Query: 83 GFSRNSLPHF 54 GF + +LPHF Sbjct: 262 GFRKRTLPHF 271 >AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 593 Score = 19.8 bits (39), Expect = 9.5 Identities = 7/17 (41%), Positives = 11/17 (64%) Frame = +3 Query: 273 KTVHYESLWMSKINYML 323 KT+ +W SKI ++L Sbjct: 14 KTLPDRGMWSSKIEFIL 30 >AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 646 Score = 19.8 bits (39), Expect = 9.5 Identities = 7/17 (41%), Positives = 11/17 (64%) Frame = +3 Query: 273 KTVHYESLWMSKINYML 323 KT+ +W SKI ++L Sbjct: 67 KTLPDRGMWSSKIEFIL 83 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 91,068 Number of Sequences: 438 Number of extensions: 1790 Number of successful extensions: 7 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 146,343 effective HSP length: 50 effective length of database: 124,443 effective search space used: 7839909 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 39 (20.8 bits)
- SilkBase 1999-2023 -