BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30692 (712 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC330.01c |rhp16|SPCC613.13c, rad16|Rad16 homolog Rhp16|Schizo... 27 2.0 SPCC330.11 |btb1||BTB/POZ domain protein Btb1|Schizosaccharomyce... 27 2.6 SPBC577.09 |||ERCC-8 homolog |Schizosaccharomyces pombe|chr 2|||... 25 8.1 >SPCC330.01c |rhp16|SPCC613.13c, rad16|Rad16 homolog Rhp16|Schizosaccharomyces pombe|chr 3|||Manual Length = 963 Score = 27.5 bits (58), Expect = 2.0 Identities = 13/34 (38%), Positives = 20/34 (58%) Frame = +3 Query: 93 FMSTIYKKIVNFQIDGT*RKV*PKIHSLLEHILL 194 F + + K I F +G + K+HSLL+HI+L Sbjct: 583 FNAEMLKPIQKFGYEGPGKLAFKKVHSLLKHIML 616 >SPCC330.11 |btb1||BTB/POZ domain protein Btb1|Schizosaccharomyces pombe|chr 3|||Manual Length = 1347 Score = 27.1 bits (57), Expect = 2.6 Identities = 21/76 (27%), Positives = 36/76 (47%) Frame = +1 Query: 484 KDFSYKQAQRHLQHGTLSQHFTLPENLFLSQFSAFFLRNIREHLGEDINVEYCPTGSLVL 663 K FS K Q+ L+ ++ ++ +S+ F+R++ +H G D+ V+ +G L Sbjct: 33 KGFSEKSGQK-LRINQKDRYGRTVLHIAVSENKNSFVRSLLQHKGIDVFVQDEESGYTAL 91 Query: 664 ASNDYAQKLEETSSLL 711 Y LE S LL Sbjct: 92 HRAIYVGNLEAASLLL 107 >SPBC577.09 |||ERCC-8 homolog |Schizosaccharomyces pombe|chr 2|||Manual Length = 404 Score = 25.4 bits (53), Expect = 8.1 Identities = 10/30 (33%), Positives = 16/30 (53%) Frame = +1 Query: 580 SAFFLRNIREHLGEDINVEYCPTGSLVLAS 669 S + ++ H G + V++CP VLAS Sbjct: 178 SGSYTHSLSGHTGNVLAVDWCPKNEFVLAS 207 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,767,444 Number of Sequences: 5004 Number of extensions: 54402 Number of successful extensions: 117 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 115 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 117 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 331187010 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -