BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30690 (318 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 08_02_1325 - 26146775-26147247,26147397-26148579 29 1.0 04_04_1375 + 33040329-33040854,33041611-33041838,33041984-330420... 26 7.4 >08_02_1325 - 26146775-26147247,26147397-26148579 Length = 551 Score = 28.7 bits (61), Expect = 1.0 Identities = 13/36 (36%), Positives = 20/36 (55%) Frame = +1 Query: 1 KKVKKKDYSKNEVKKQTNDDDYVLNKLFAKAAVKNA 108 K KK K++ K++ DDD N+ KA ++NA Sbjct: 44 KHSKKHKREKHKDKRKNKDDDRYTNQTLEKATLRNA 79 >04_04_1375 + 33040329-33040854,33041611-33041838,33041984-33042081, 33042406-33042450,33042678-33042846,33042917-33043026, 33043983-33044051,33044085-33044158,33044738-33044804, 33044876-33044988,33045148-33045237,33046030-33046144, 33046230-33046388 Length = 620 Score = 25.8 bits (54), Expect = 7.4 Identities = 11/19 (57%), Positives = 13/19 (68%) Frame = +1 Query: 1 KKVKKKDYSKNEVKKQTND 57 K KKDYSK+ V QTN+ Sbjct: 227 KSTDKKDYSKSNVGYQTNN 245 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 4,401,589 Number of Sequences: 37544 Number of extensions: 45218 Number of successful extensions: 105 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 104 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 104 length of database: 14,793,348 effective HSP length: 72 effective length of database: 12,090,180 effective search space used: 398975940 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -