BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30690 (318 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value L04791-1|AAA52397.1| 1493|Homo sapiens excision repair protein p... 38 0.009 BC127104-1|AAI27105.1| 1493|Homo sapiens excision repair cross-c... 38 0.009 AY204752-1|AAO13487.1| 1493|Homo sapiens excision repair cross-c... 38 0.009 AL138760-2|CAH70291.1| 1493|Homo sapiens excision repair cross-c... 38 0.009 AB209504-1|BAD92741.1| 870|Homo sapiens excision repair cross-c... 38 0.009 BC039300-1|AAH39300.1| 335|Homo sapiens SRGAP3 protein protein. 30 1.7 AF464189-1|AAN57784.1| 1075|Homo sapiens WAVE-associated Rac GTP... 30 1.7 AF427144-1|AAN07095.1| 1099|Homo sapiens MEGAP transcript varian... 30 1.7 AB032982-1|BAA86470.1| 348|Homo sapiens KIAA1156 protein protein. 30 1.7 AB007871-1|BAA24841.2| 1061|Homo sapiens KIAA0411 protein. 30 1.7 U31216-1|AAA87844.1| 906|Homo sapiens metabotropic glutamate re... 28 6.9 U31215-1|AAA87843.1| 1194|Homo sapiens metabotropic glutamate re... 28 6.9 L76631-1|AAB05338.1| 906|Homo sapiens metabotropic glutamate re... 28 6.9 L76627-1|AAB05337.1| 1194|Homo sapiens metabotropic glutamate re... 28 6.9 AL592423-3|CAH71182.1| 1194|Homo sapiens glutamate receptor, met... 28 6.9 AL592423-2|CAH71181.1| 906|Homo sapiens glutamate receptor, met... 28 6.9 AL096867-2|CAI20336.1| 1194|Homo sapiens glutamate receptor, met... 28 6.9 AL096867-1|CAI20335.1| 906|Homo sapiens glutamate receptor, met... 28 6.9 AL035698-3|CAI22469.1| 1194|Homo sapiens glutamate receptor, met... 28 6.9 AL035698-2|CAI22468.1| 906|Homo sapiens glutamate receptor, met... 28 6.9 AB208837-1|BAD92074.1| 901|Homo sapiens glutamate receptor, met... 28 6.9 >L04791-1|AAA52397.1| 1493|Homo sapiens excision repair protein protein. Length = 1493 Score = 37.5 bits (83), Expect = 0.009 Identities = 18/41 (43%), Positives = 29/41 (70%), Gaps = 1/41 (2%) Frame = +1 Query: 10 KKKDYSKNEVKKQTNDDDYVLNKLFAKA-AVKNALQHDVVV 129 K+ +K+E K+Q+NDD YVL KLF K+ V + ++HD ++ Sbjct: 1233 KQDSENKSEAKEQSNDD-YVLEKLFKKSVGVHSVMKHDAIM 1272 >BC127104-1|AAI27105.1| 1493|Homo sapiens excision repair cross-complementing rodent repair deficiency, complementation g protein. Length = 1493 Score = 37.5 bits (83), Expect = 0.009 Identities = 18/41 (43%), Positives = 29/41 (70%), Gaps = 1/41 (2%) Frame = +1 Query: 10 KKKDYSKNEVKKQTNDDDYVLNKLFAKA-AVKNALQHDVVV 129 K+ +K+E K+Q+NDD YVL KLF K+ V + ++HD ++ Sbjct: 1233 KQDSENKSEAKEQSNDD-YVLEKLFKKSVGVHSVMKHDAIM 1272 >AY204752-1|AAO13487.1| 1493|Homo sapiens excision repair cross-complementing rodent repair deficiency, complementation g protein. Length = 1493 Score = 37.5 bits (83), Expect = 0.009 Identities = 18/41 (43%), Positives = 29/41 (70%), Gaps = 1/41 (2%) Frame = +1 Query: 10 KKKDYSKNEVKKQTNDDDYVLNKLFAKA-AVKNALQHDVVV 129 K+ +K+E K+Q+NDD YVL KLF K+ V + ++HD ++ Sbjct: 1233 KQDSENKSEAKEQSNDD-YVLEKLFKKSVGVHSVMKHDAIM 1272 >AL138760-2|CAH70291.1| 1493|Homo sapiens excision repair cross-complementing rodent repairnt regulator of chromatin, sub protein. Length = 1493 Score = 37.5 bits (83), Expect = 0.009 Identities = 18/41 (43%), Positives = 29/41 (70%), Gaps = 1/41 (2%) Frame = +1 Query: 10 KKKDYSKNEVKKQTNDDDYVLNKLFAKA-AVKNALQHDVVV 129 K+ +K+E K+Q+NDD YVL KLF K+ V + ++HD ++ Sbjct: 1233 KQDSENKSEAKEQSNDD-YVLEKLFKKSVGVHSVMKHDAIM 1272 >AB209504-1|BAD92741.1| 870|Homo sapiens excision repair cross-complementing rodent repair deficiency, complementation g protein. Length = 870 Score = 37.5 bits (83), Expect = 0.009 Identities = 18/41 (43%), Positives = 29/41 (70%), Gaps = 1/41 (2%) Frame = +1 Query: 10 KKKDYSKNEVKKQTNDDDYVLNKLFAKA-AVKNALQHDVVV 129 K+ +K+E K+Q+NDD YVL KLF K+ V + ++HD ++ Sbjct: 610 KQDSENKSEAKEQSNDD-YVLEKLFKKSVGVHSVMKHDAIM 649 >BC039300-1|AAH39300.1| 335|Homo sapiens SRGAP3 protein protein. Length = 335 Score = 29.9 bits (64), Expect = 1.7 Identities = 14/41 (34%), Positives = 23/41 (56%) Frame = +1 Query: 1 KKVKKKDYSKNEVKKQTNDDDYVLNKLFAKAAVKNALQHDV 123 K+ ++ YS+N++K +DY+LN AA+ HDV Sbjct: 102 KEKRQAKYSENKLKCTKARNDYLLNLAATNAAISKYYIHDV 142 >AF464189-1|AAN57784.1| 1075|Homo sapiens WAVE-associated Rac GTPase activating protein protein. Length = 1075 Score = 29.9 bits (64), Expect = 1.7 Identities = 14/41 (34%), Positives = 23/41 (56%) Frame = +1 Query: 1 KKVKKKDYSKNEVKKQTNDDDYVLNKLFAKAAVKNALQHDV 123 K+ ++ YS+N++K +DY+LN AA+ HDV Sbjct: 222 KEKRQAKYSENKLKCTKARNDYLLNLAATNAAISKYYIHDV 262 >AF427144-1|AAN07095.1| 1099|Homo sapiens MEGAP transcript variant a protein. Length = 1099 Score = 29.9 bits (64), Expect = 1.7 Identities = 14/41 (34%), Positives = 23/41 (56%) Frame = +1 Query: 1 KKVKKKDYSKNEVKKQTNDDDYVLNKLFAKAAVKNALQHDV 123 K+ ++ YS+N++K +DY+LN AA+ HDV Sbjct: 222 KEKRQAKYSENKLKCTKARNDYLLNLAATNAAISKYYIHDV 262 >AB032982-1|BAA86470.1| 348|Homo sapiens KIAA1156 protein protein. Length = 348 Score = 29.9 bits (64), Expect = 1.7 Identities = 14/41 (34%), Positives = 23/41 (56%) Frame = +1 Query: 1 KKVKKKDYSKNEVKKQTNDDDYVLNKLFAKAAVKNALQHDV 123 K+ ++ YS+N++K +DY+LN AA+ HDV Sbjct: 91 KEKRQAKYSENKLKCTKARNDYLLNLAATNAAISKYYIHDV 131 >AB007871-1|BAA24841.2| 1061|Homo sapiens KIAA0411 protein. Length = 1061 Score = 29.9 bits (64), Expect = 1.7 Identities = 14/41 (34%), Positives = 23/41 (56%) Frame = +1 Query: 1 KKVKKKDYSKNEVKKQTNDDDYVLNKLFAKAAVKNALQHDV 123 K+ ++ YS+N++K +DY+LN AA+ HDV Sbjct: 208 KEKRQAKYSENKLKCTKARNDYLLNLAATNAAISKYYIHDV 248 >U31216-1|AAA87844.1| 906|Homo sapiens metabotropic glutamate receptor 1 beta protein. Length = 906 Score = 27.9 bits (59), Expect = 6.9 Identities = 11/15 (73%), Positives = 13/15 (86%) Frame = -2 Query: 158 LCFFSLSAKPTTTSC 114 +C F+L AKPTTTSC Sbjct: 643 VCPFTLIAKPTTTSC 657 >U31215-1|AAA87843.1| 1194|Homo sapiens metabotropic glutamate receptor 1 alpha protein. Length = 1194 Score = 27.9 bits (59), Expect = 6.9 Identities = 11/15 (73%), Positives = 13/15 (86%) Frame = -2 Query: 158 LCFFSLSAKPTTTSC 114 +C F+L AKPTTTSC Sbjct: 643 VCPFTLIAKPTTTSC 657 >L76631-1|AAB05338.1| 906|Homo sapiens metabotropic glutamate receptor protein. Length = 906 Score = 27.9 bits (59), Expect = 6.9 Identities = 11/15 (73%), Positives = 13/15 (86%) Frame = -2 Query: 158 LCFFSLSAKPTTTSC 114 +C F+L AKPTTTSC Sbjct: 643 VCPFTLIAKPTTTSC 657 >L76627-1|AAB05337.1| 1194|Homo sapiens metabotropic glutamate receptor 1 alpha protein. Length = 1194 Score = 27.9 bits (59), Expect = 6.9 Identities = 11/15 (73%), Positives = 13/15 (86%) Frame = -2 Query: 158 LCFFSLSAKPTTTSC 114 +C F+L AKPTTTSC Sbjct: 643 VCPFTLIAKPTTTSC 657 >AL592423-3|CAH71182.1| 1194|Homo sapiens glutamate receptor, metabotropic 1 protein. Length = 1194 Score = 27.9 bits (59), Expect = 6.9 Identities = 11/15 (73%), Positives = 13/15 (86%) Frame = -2 Query: 158 LCFFSLSAKPTTTSC 114 +C F+L AKPTTTSC Sbjct: 643 VCPFTLIAKPTTTSC 657 >AL592423-2|CAH71181.1| 906|Homo sapiens glutamate receptor, metabotropic 1 protein. Length = 906 Score = 27.9 bits (59), Expect = 6.9 Identities = 11/15 (73%), Positives = 13/15 (86%) Frame = -2 Query: 158 LCFFSLSAKPTTTSC 114 +C F+L AKPTTTSC Sbjct: 643 VCPFTLIAKPTTTSC 657 >AL096867-2|CAI20336.1| 1194|Homo sapiens glutamate receptor, metabotropic 1 protein. Length = 1194 Score = 27.9 bits (59), Expect = 6.9 Identities = 11/15 (73%), Positives = 13/15 (86%) Frame = -2 Query: 158 LCFFSLSAKPTTTSC 114 +C F+L AKPTTTSC Sbjct: 643 VCPFTLIAKPTTTSC 657 >AL096867-1|CAI20335.1| 906|Homo sapiens glutamate receptor, metabotropic 1 protein. Length = 906 Score = 27.9 bits (59), Expect = 6.9 Identities = 11/15 (73%), Positives = 13/15 (86%) Frame = -2 Query: 158 LCFFSLSAKPTTTSC 114 +C F+L AKPTTTSC Sbjct: 643 VCPFTLIAKPTTTSC 657 >AL035698-3|CAI22469.1| 1194|Homo sapiens glutamate receptor, metabotropic 1 protein. Length = 1194 Score = 27.9 bits (59), Expect = 6.9 Identities = 11/15 (73%), Positives = 13/15 (86%) Frame = -2 Query: 158 LCFFSLSAKPTTTSC 114 +C F+L AKPTTTSC Sbjct: 643 VCPFTLIAKPTTTSC 657 >AL035698-2|CAI22468.1| 906|Homo sapiens glutamate receptor, metabotropic 1 protein. Length = 906 Score = 27.9 bits (59), Expect = 6.9 Identities = 11/15 (73%), Positives = 13/15 (86%) Frame = -2 Query: 158 LCFFSLSAKPTTTSC 114 +C F+L AKPTTTSC Sbjct: 643 VCPFTLIAKPTTTSC 657 >AB208837-1|BAD92074.1| 901|Homo sapiens glutamate receptor, metabotropic 1 variant protein. Length = 901 Score = 27.9 bits (59), Expect = 6.9 Identities = 11/15 (73%), Positives = 13/15 (86%) Frame = -2 Query: 158 LCFFSLSAKPTTTSC 114 +C F+L AKPTTTSC Sbjct: 638 VCPFTLIAKPTTTSC 652 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 25,268,560 Number of Sequences: 237096 Number of extensions: 302924 Number of successful extensions: 4334 Number of sequences better than 10.0: 21 Number of HSP's better than 10.0 without gapping: 4324 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4329 length of database: 76,859,062 effective HSP length: 79 effective length of database: 58,128,478 effective search space used: 1511340428 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -