BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30690 (318 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z81072-15|CAB03026.2| 1262|Caenorhabditis elegans Hypothetical p... 28 1.7 Z81048-10|CAB02845.2| 1262|Caenorhabditis elegans Hypothetical p... 28 1.7 >Z81072-15|CAB03026.2| 1262|Caenorhabditis elegans Hypothetical protein F30A10.10 protein. Length = 1262 Score = 27.9 bits (59), Expect = 1.7 Identities = 13/32 (40%), Positives = 20/32 (62%) Frame = +1 Query: 1 KKVKKKDYSKNEVKKQTNDDDYVLNKLFAKAA 96 KK KKK+ S+NE KK+ +D+ + + A A Sbjct: 526 KKKKKKEASENEEKKKNEEDEALSAAIAASEA 557 >Z81048-10|CAB02845.2| 1262|Caenorhabditis elegans Hypothetical protein F30A10.10 protein. Length = 1262 Score = 27.9 bits (59), Expect = 1.7 Identities = 13/32 (40%), Positives = 20/32 (62%) Frame = +1 Query: 1 KKVKKKDYSKNEVKKQTNDDDYVLNKLFAKAA 96 KK KKK+ S+NE KK+ +D+ + + A A Sbjct: 526 KKKKKKEASENEEKKKNEEDEALSAAIAASEA 557 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 4,394,775 Number of Sequences: 27780 Number of extensions: 53234 Number of successful extensions: 248 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 237 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 248 length of database: 12,740,198 effective HSP length: 71 effective length of database: 10,767,818 effective search space used: 366105812 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -