BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30684 (756 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY055847-1|AAL23667.2| 312|Tribolium castaneum cephalothorax pr... 26 0.37 AY055846-1|AAL26542.2| 312|Tribolium castaneum cephalothorax pr... 26 0.37 AY055845-1|AAL23670.2| 230|Tribolium castaneum cephalothorax pr... 26 0.37 AF426396-1|AAL27023.2| 312|Tribolium castaneum cephalothorax pr... 26 0.37 AF426395-1|AAL27022.2| 297|Tribolium castaneum cephalothorax pr... 26 0.37 AF416773-1|AAL09697.1| 268|Tribolium castaneum cephalothorax pr... 26 0.37 AF321227-2|AAK16422.1| 312|Tribolium castaneum Scr protein. 26 0.37 AF261823-1|AAG13010.1| 157|Tribolium castaneum cephalothorax pr... 26 0.37 AF227628-1|AAF42868.1| 312|Tribolium castaneum sex combs reduce... 26 0.37 AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like pr... 23 2.6 EF222295-1|ABN79655.1| 146|Tribolium castaneum arginine vasopre... 23 3.5 DQ855499-1|ABH88186.1| 124|Tribolium castaneum chemosensory pro... 21 8.0 AF217810-1|AAF71998.1| 431|Tribolium castaneum fork head orthol... 21 8.0 >AY055847-1|AAL23667.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 25.8 bits (54), Expect = 0.37 Identities = 20/68 (29%), Positives = 29/68 (42%), Gaps = 2/68 (2%) Frame = +3 Query: 543 QYPNDLTHHNPHAEAPKPKPELKLEIRNPDPLRRTNQP-LNVKDLETRT-SQSDKSQGAT 716 Q PN TH P A + +P L P + L T + S + KS G T Sbjct: 87 QSPNTQTH--PSASCKYADSTSSTGVASPQDLSTNGAPPRSTPPLSTPSNSNATKSSGLT 144 Query: 717 TPKTISTA 740 +P ++ST+ Sbjct: 145 SPLSVSTS 152 >AY055846-1|AAL26542.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 25.8 bits (54), Expect = 0.37 Identities = 20/68 (29%), Positives = 29/68 (42%), Gaps = 2/68 (2%) Frame = +3 Query: 543 QYPNDLTHHNPHAEAPKPKPELKLEIRNPDPLRRTNQP-LNVKDLETRT-SQSDKSQGAT 716 Q PN TH P A + +P L P + L T + S + KS G T Sbjct: 87 QSPNTQTH--PSASCKYADSTSSTGVASPQDLSTNGAPPRSTPPLSTPSNSNATKSSGLT 144 Query: 717 TPKTISTA 740 +P ++ST+ Sbjct: 145 SPLSVSTS 152 >AY055845-1|AAL23670.2| 230|Tribolium castaneum cephalothorax protein. Length = 230 Score = 25.8 bits (54), Expect = 0.37 Identities = 20/68 (29%), Positives = 29/68 (42%), Gaps = 2/68 (2%) Frame = +3 Query: 543 QYPNDLTHHNPHAEAPKPKPELKLEIRNPDPLRRTNQP-LNVKDLETRT-SQSDKSQGAT 716 Q PN TH P A + +P L P + L T + S + KS G T Sbjct: 87 QSPNTQTH--PSASCKYADSTSSTGVASPQDLSTNGAPPRSTPPLSTPSNSNATKSSGLT 144 Query: 717 TPKTISTA 740 +P ++ST+ Sbjct: 145 SPLSVSTS 152 >AF426396-1|AAL27023.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 25.8 bits (54), Expect = 0.37 Identities = 20/68 (29%), Positives = 29/68 (42%), Gaps = 2/68 (2%) Frame = +3 Query: 543 QYPNDLTHHNPHAEAPKPKPELKLEIRNPDPLRRTNQP-LNVKDLETRT-SQSDKSQGAT 716 Q PN TH P A + +P L P + L T + S + KS G T Sbjct: 87 QSPNTQTH--PSASCKYADSTSSTGVASPQDLSTNGAPPRSTPPLSTPSNSNATKSSGLT 144 Query: 717 TPKTISTA 740 +P ++ST+ Sbjct: 145 SPLSVSTS 152 >AF426395-1|AAL27022.2| 297|Tribolium castaneum cephalothorax protein. Length = 297 Score = 25.8 bits (54), Expect = 0.37 Identities = 20/68 (29%), Positives = 29/68 (42%), Gaps = 2/68 (2%) Frame = +3 Query: 543 QYPNDLTHHNPHAEAPKPKPELKLEIRNPDPLRRTNQP-LNVKDLETRT-SQSDKSQGAT 716 Q PN TH P A + +P L P + L T + S + KS G T Sbjct: 87 QSPNTQTH--PSASCKYADSTSSTGVASPQDLSTNGAPPRSTPPLSTPSNSNATKSSGLT 144 Query: 717 TPKTISTA 740 +P ++ST+ Sbjct: 145 SPLSVSTS 152 >AF416773-1|AAL09697.1| 268|Tribolium castaneum cephalothorax protein. Length = 268 Score = 25.8 bits (54), Expect = 0.37 Identities = 20/68 (29%), Positives = 29/68 (42%), Gaps = 2/68 (2%) Frame = +3 Query: 543 QYPNDLTHHNPHAEAPKPKPELKLEIRNPDPLRRTNQP-LNVKDLETRT-SQSDKSQGAT 716 Q PN TH P A + +P L P + L T + S + KS G T Sbjct: 43 QSPNTQTH--PSASCKYADSTSSTGVASPQDLSTNGAPPRSTPPLSTPSNSNATKSSGLT 100 Query: 717 TPKTISTA 740 +P ++ST+ Sbjct: 101 SPLSVSTS 108 >AF321227-2|AAK16422.1| 312|Tribolium castaneum Scr protein. Length = 312 Score = 25.8 bits (54), Expect = 0.37 Identities = 20/68 (29%), Positives = 29/68 (42%), Gaps = 2/68 (2%) Frame = +3 Query: 543 QYPNDLTHHNPHAEAPKPKPELKLEIRNPDPLRRTNQP-LNVKDLETRT-SQSDKSQGAT 716 Q PN TH P A + +P L P + L T + S + KS G T Sbjct: 87 QSPNTQTH--PSASCKYADSTSSTGVASPQDLSTNGAPPRSTPPLSTPSNSNATKSSGLT 144 Query: 717 TPKTISTA 740 +P ++ST+ Sbjct: 145 SPLSVSTS 152 >AF261823-1|AAG13010.1| 157|Tribolium castaneum cephalothorax protein. Length = 157 Score = 25.8 bits (54), Expect = 0.37 Identities = 20/68 (29%), Positives = 29/68 (42%), Gaps = 2/68 (2%) Frame = +3 Query: 543 QYPNDLTHHNPHAEAPKPKPELKLEIRNPDPLRRTNQP-LNVKDLETRT-SQSDKSQGAT 716 Q PN TH P A + +P L P + L T + S + KS G T Sbjct: 87 QSPNTQTH--PSASCKYADSTSSTGVASPQDLSTNGAPPRSTPPLSTPSNSNATKSSGLT 144 Query: 717 TPKTISTA 740 +P ++ST+ Sbjct: 145 SPLSVSTS 152 >AF227628-1|AAF42868.1| 312|Tribolium castaneum sex combs reduced Scr protein. Length = 312 Score = 25.8 bits (54), Expect = 0.37 Identities = 20/68 (29%), Positives = 29/68 (42%), Gaps = 2/68 (2%) Frame = +3 Query: 543 QYPNDLTHHNPHAEAPKPKPELKLEIRNPDPLRRTNQP-LNVKDLETRT-SQSDKSQGAT 716 Q PN TH P A + +P L P + L T + S + KS G T Sbjct: 87 QSPNTQTH--PSASCKYADSTSSTGVASPQDLSTNGAPPRSTPPLSTPSNSNATKSSGLT 144 Query: 717 TPKTISTA 740 +P ++ST+ Sbjct: 145 SPLSVSTS 152 >AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like protein protein. Length = 1156 Score = 23.0 bits (47), Expect = 2.6 Identities = 13/51 (25%), Positives = 21/51 (41%) Frame = +2 Query: 500 IFKAKVPASQEPREAVP**LDASQPSCRSAETETRTQARNTKPGSPKTNEP 652 +F P P + + LD S+ +S +KPG+P + EP Sbjct: 190 VFPVDAPMHSPPGDGI---LDFSKRGQKSDADSDSDVVNLSKPGTPPSGEP 237 >EF222295-1|ABN79655.1| 146|Tribolium castaneum arginine vasopressin-like peptide protein. Length = 146 Score = 22.6 bits (46), Expect = 3.5 Identities = 8/25 (32%), Positives = 13/25 (52%) Frame = +3 Query: 171 SAQITLDGIRCGQLICQLDEYCSPE 245 + + DGI C Q C D+ C+ + Sbjct: 101 TGRCAFDGICCSQDSCHADKSCASD 125 >DQ855499-1|ABH88186.1| 124|Tribolium castaneum chemosensory protein 13 protein. Length = 124 Score = 21.4 bits (43), Expect = 8.0 Identities = 9/22 (40%), Positives = 12/22 (54%) Frame = +3 Query: 495 WRYLKQKFQPAKNRVKQYPNDL 560 W L++KF P K+Y N L Sbjct: 96 WEQLQKKFDPQGIYKKRYQNYL 117 >AF217810-1|AAF71998.1| 431|Tribolium castaneum fork head orthologue protein. Length = 431 Score = 21.4 bits (43), Expect = 8.0 Identities = 8/19 (42%), Positives = 10/19 (52%) Frame = -2 Query: 188 QGDLSGGDAGENQDAHESR 132 +GDL GGD N +R Sbjct: 109 RGDLGGGDTSPNSALQRAR 127 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 167,173 Number of Sequences: 336 Number of extensions: 3477 Number of successful extensions: 19 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 18 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 19 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 20234955 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -