BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30676 (593 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BT024251-1|ABC86313.1| 31|Drosophila melanogaster IP15867p pro... 30 2.7 AY113590-1|AAM29595.1| 705|Drosophila melanogaster RH41322p pro... 29 6.3 AE013599-3538|AAF46952.3| 705|Drosophila melanogaster CG9882-PA... 29 6.3 >BT024251-1|ABC86313.1| 31|Drosophila melanogaster IP15867p protein. Length = 31 Score = 29.9 bits (64), Expect = 2.7 Identities = 10/22 (45%), Positives = 17/22 (77%) Frame = -2 Query: 592 FFFFFLEIDKCTRLYLAIKHRI 527 FFFFFL ++KC +YL + +++ Sbjct: 6 FFFFFLFVNKCLYIYLLLANKL 27 >AY113590-1|AAM29595.1| 705|Drosophila melanogaster RH41322p protein. Length = 705 Score = 28.7 bits (61), Expect = 6.3 Identities = 18/48 (37%), Positives = 23/48 (47%) Frame = -1 Query: 515 LLKKVKRNTPNEFKILLHSCFFYSLPIRWNRLLQIRAGG*GAHGLKLR 372 LL K+K P KI S Y+LP+ + L +IRA G LR Sbjct: 516 LLTKIKDRLPEGVKISPCSARIYALPVEFLDLHKIRAPVGSCEGFDLR 563 >AE013599-3538|AAF46952.3| 705|Drosophila melanogaster CG9882-PA protein. Length = 705 Score = 28.7 bits (61), Expect = 6.3 Identities = 18/48 (37%), Positives = 23/48 (47%) Frame = -1 Query: 515 LLKKVKRNTPNEFKILLHSCFFYSLPIRWNRLLQIRAGG*GAHGLKLR 372 LL K+K P KI S Y+LP+ + L +IRA G LR Sbjct: 516 LLTKIKDRLPEGVKISPCSARIYALPVEFLDLHKIRAPVGSCEGFDLR 563 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,555,313 Number of Sequences: 53049 Number of extensions: 380924 Number of successful extensions: 752 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 743 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 752 length of database: 24,988,368 effective HSP length: 81 effective length of database: 20,691,399 effective search space used: 2400202284 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -