BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30676 (593 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ869053-1|ABJ09600.1| 459|Apis mellifera capa-like receptor pr... 23 3.0 DQ244074-1|ABB36784.1| 517|Apis mellifera cytochrome P450 monoo... 22 3.9 D79207-1|BAA23639.1| 432|Apis mellifera milk protein protein. 21 6.9 AF388203-1|AAM73637.1| 432|Apis mellifera major royal jelly pro... 21 6.9 AF000633-1|AAC61895.1| 432|Apis mellifera major royal jelly pro... 21 6.9 AY338499-1|AAR08420.1| 500|Apis mellifera Kruppel-like protein ... 21 9.1 >DQ869053-1|ABJ09600.1| 459|Apis mellifera capa-like receptor protein. Length = 459 Score = 22.6 bits (46), Expect = 3.0 Identities = 13/41 (31%), Positives = 21/41 (51%) Frame = -3 Query: 327 IYHRIGIATH*EDPARNSVGCVHGIIRSLS*SKNSIESVFS 205 +Y RIG+ + A N G VHG + + S+ +I + S Sbjct: 224 LYIRIGLRIQSDSLAENVEGYVHGETKQVQ-SRKTITRMLS 263 >DQ244074-1|ABB36784.1| 517|Apis mellifera cytochrome P450 monooxygenase protein. Length = 517 Score = 22.2 bits (45), Expect = 3.9 Identities = 7/19 (36%), Positives = 13/19 (68%) Frame = -2 Query: 469 YCTPVFFIPYLFAGIGYYR 413 + P+F ++F+ IGYY+ Sbjct: 57 FSLPIFGTRWIFSCIGYYK 75 >D79207-1|BAA23639.1| 432|Apis mellifera milk protein protein. Length = 432 Score = 21.4 bits (43), Expect = 6.9 Identities = 9/27 (33%), Positives = 13/27 (48%) Frame = +2 Query: 131 IYLSKFVCNEIYYVIFADLKTSD*PEN 211 +Y S +YYV +TSD +N Sbjct: 265 LYYSPVASTSLYYVNTEQFRTSDYQQN 291 >AF388203-1|AAM73637.1| 432|Apis mellifera major royal jelly protein MRJP1 protein. Length = 432 Score = 21.4 bits (43), Expect = 6.9 Identities = 9/27 (33%), Positives = 13/27 (48%) Frame = +2 Query: 131 IYLSKFVCNEIYYVIFADLKTSD*PEN 211 +Y S +YYV +TSD +N Sbjct: 265 LYYSPVASTSLYYVNTEQFRTSDYQQN 291 >AF000633-1|AAC61895.1| 432|Apis mellifera major royal jelly protein MRJP1 protein. Length = 432 Score = 21.4 bits (43), Expect = 6.9 Identities = 9/27 (33%), Positives = 13/27 (48%) Frame = +2 Query: 131 IYLSKFVCNEIYYVIFADLKTSD*PEN 211 +Y S +YYV +TSD +N Sbjct: 265 LYYSPVASTSLYYVNTEQFRTSDYQQN 291 >AY338499-1|AAR08420.1| 500|Apis mellifera Kruppel-like protein 1 protein. Length = 500 Score = 21.0 bits (42), Expect = 9.1 Identities = 9/26 (34%), Positives = 12/26 (46%) Frame = -2 Query: 427 IGYYRYARAGRELTGSNSEEISNTSP 350 +GYY+ + T S EIS P Sbjct: 2 VGYYQMKQITNSTTMSVKNEISTVEP 27 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 139,430 Number of Sequences: 438 Number of extensions: 2618 Number of successful extensions: 11 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 17359926 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -