BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30673 (742 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY362544-1|AAQ63456.1| 268|Tribolium castaneum chitin synthase ... 32 0.006 AY362543-1|AAQ63455.1| 677|Tribolium castaneum chitin synthase ... 32 0.006 AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ... 32 0.006 AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ... 32 0.006 AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase ... 28 0.091 AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase ... 28 0.091 AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase ... 28 0.091 AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase ... 28 0.091 AJ621748-1|CAF21851.1| 228|Tribolium castaneum zinc finger tran... 23 2.6 DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome ad... 22 6.0 >AY362544-1|AAQ63456.1| 268|Tribolium castaneum chitin synthase protein. Length = 268 Score = 31.9 bits (69), Expect = 0.006 Identities = 14/47 (29%), Positives = 21/47 (44%) Frame = -1 Query: 247 YITIVRILGPRVSFYHPMRAGGFVWWSRGHSNVSHWGEWRYQQRIAC 107 Y+ + LG HP+ +GG VW+ V HW + + I C Sbjct: 177 YMKKNKTLGAACGRIHPIGSGGMVWYQMFEYAVGHWMQKATEHVIGC 223 >AY362543-1|AAQ63455.1| 677|Tribolium castaneum chitin synthase protein. Length = 677 Score = 31.9 bits (69), Expect = 0.006 Identities = 14/47 (29%), Positives = 21/47 (44%) Frame = -1 Query: 247 YITIVRILGPRVSFYHPMRAGGFVWWSRGHSNVSHWGEWRYQQRIAC 107 Y+ + LG HP+ +GG VW+ V HW + + I C Sbjct: 491 YMKKNKTLGAACGRIHPIGSGGMVWYQMFEYAVGHWMQKATEHVIGC 537 >AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase protein. Length = 1464 Score = 31.9 bits (69), Expect = 0.006 Identities = 14/47 (29%), Positives = 21/47 (44%) Frame = -1 Query: 247 YITIVRILGPRVSFYHPMRAGGFVWWSRGHSNVSHWGEWRYQQRIAC 107 Y+ + LG HP+ +GG VW+ V HW + + I C Sbjct: 724 YMKKNKTLGAACGRIHPIGSGGMVWYQMFEYAVGHWMQKATEHVIGC 770 >AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase CHS2 protein. Length = 1464 Score = 31.9 bits (69), Expect = 0.006 Identities = 14/47 (29%), Positives = 21/47 (44%) Frame = -1 Query: 247 YITIVRILGPRVSFYHPMRAGGFVWWSRGHSNVSHWGEWRYQQRIAC 107 Y+ + LG HP+ +GG VW+ V HW + + I C Sbjct: 724 YMKKNKTLGAACGRIHPIGSGGMVWYQMFEYAVGHWMQKATEHVIGC 770 >AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase variant 2 protein. Length = 1558 Score = 27.9 bits (59), Expect = 0.091 Identities = 12/42 (28%), Positives = 18/42 (42%) Frame = -1 Query: 232 RILGPRVSFYHPMRAGGFVWWSRGHSNVSHWGEWRYQQRIAC 107 R LG HP+ +G VW+ + HW + + I C Sbjct: 756 RNLGAACGRIHPVGSGPMVWYQMFEYAIGHWLQKATEHVIGC 797 >AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase variant 1 protein. Length = 1558 Score = 27.9 bits (59), Expect = 0.091 Identities = 12/42 (28%), Positives = 18/42 (42%) Frame = -1 Query: 232 RILGPRVSFYHPMRAGGFVWWSRGHSNVSHWGEWRYQQRIAC 107 R LG HP+ +G VW+ + HW + + I C Sbjct: 756 RNLGAACGRIHPVGSGPMVWYQMFEYAIGHWLQKATEHVIGC 797 >AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase CHS1B protein. Length = 1558 Score = 27.9 bits (59), Expect = 0.091 Identities = 12/42 (28%), Positives = 18/42 (42%) Frame = -1 Query: 232 RILGPRVSFYHPMRAGGFVWWSRGHSNVSHWGEWRYQQRIAC 107 R LG HP+ +G VW+ + HW + + I C Sbjct: 756 RNLGAACGRIHPVGSGPMVWYQMFEYAIGHWLQKATEHVIGC 797 >AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase CHS1A protein. Length = 1558 Score = 27.9 bits (59), Expect = 0.091 Identities = 12/42 (28%), Positives = 18/42 (42%) Frame = -1 Query: 232 RILGPRVSFYHPMRAGGFVWWSRGHSNVSHWGEWRYQQRIAC 107 R LG HP+ +G VW+ + HW + + I C Sbjct: 756 RNLGAACGRIHPVGSGPMVWYQMFEYAIGHWLQKATEHVIGC 797 >AJ621748-1|CAF21851.1| 228|Tribolium castaneum zinc finger transcription factor protein. Length = 228 Score = 23.0 bits (47), Expect = 2.6 Identities = 11/28 (39%), Positives = 18/28 (64%) Frame = -2 Query: 372 RSKSAFSELEPFSGSDFDFLTEGTTPSS 289 RS SAFS ++P S D+ + + +P+S Sbjct: 149 RSSSAFSYIKPSSERDYFSVKKLPSPAS 176 >DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome adhesion molecule splicevariant 3.12.3.1 protein. Length = 1639 Score = 21.8 bits (44), Expect = 6.0 Identities = 8/20 (40%), Positives = 11/20 (55%) Frame = +1 Query: 490 TVRLRPHHSD*RMAKQYNLH 549 T +L+PH SD Y +H Sbjct: 1413 TFKLKPHESDVEPIHGYTIH 1432 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 175,087 Number of Sequences: 336 Number of extensions: 3927 Number of successful extensions: 14 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 14 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 19884055 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -