BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30667 (696 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_O77339 Cluster: Putative uncharacterized protein MAL3P4... 33 6.7 UniRef50_A5DXA0 Cluster: Putative uncharacterized protein; n=1; ... 33 6.7 >UniRef50_O77339 Cluster: Putative uncharacterized protein MAL3P4.3; n=2; Eukaryota|Rep: Putative uncharacterized protein MAL3P4.3 - Plasmodium falciparum (isolate 3D7) Length = 784 Score = 33.1 bits (72), Expect = 6.7 Identities = 19/47 (40%), Positives = 22/47 (46%), Gaps = 1/47 (2%) Frame = -2 Query: 572 LFERGKVNWSSIKKTSNCLC*YQIKRTFS-YKDKCCVLSKISLKPNI 435 LF+ + KKTSNCL Y K YK+KC L K NI Sbjct: 705 LFKNSTKQKNKTKKTSNCLITYDFKNLQQIYKEKCIELKKKKTTNNI 751 >UniRef50_A5DXA0 Cluster: Putative uncharacterized protein; n=1; Lodderomyces elongisporus NRRL YB-4239|Rep: Putative uncharacterized protein - Lodderomyces elongisporus (Yeast) (Saccharomyces elongisporus) Length = 1637 Score = 33.1 bits (72), Expect = 6.7 Identities = 15/40 (37%), Positives = 25/40 (62%), Gaps = 1/40 (2%) Frame = -2 Query: 623 KVKILEIIKNETKK-LLQLFERGKVNWSSIKKTSNCLC*Y 507 K I+++ KNET++ L QL + G +N + ++NC C Y Sbjct: 312 KQSIMKMFKNETRQHLQQLLQNGVLNNQNASSSNNCACKY 351 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 576,567,714 Number of Sequences: 1657284 Number of extensions: 10138741 Number of successful extensions: 19465 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 18959 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 19459 length of database: 575,637,011 effective HSP length: 98 effective length of database: 413,223,179 effective search space used: 54958682807 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -