BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30638 (783 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ015969-1|AAY81926.1| 397|Apis mellifera stargazin related pro... 23 2.4 AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase... 23 2.4 AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein pr... 22 5.6 D79208-1|BAA11466.1| 567|Apis mellifera alpha-glucosidase protein. 22 7.4 AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. 22 7.4 AB253417-1|BAE86928.1| 567|Apis mellifera alpha-glucosidase pro... 22 7.4 AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter... 21 9.8 AY336529-1|AAQ02340.1| 712|Apis mellifera transferrin protein. 21 9.8 AY336528-1|AAQ02339.1| 712|Apis mellifera transferrin protein. 21 9.8 AY217097-1|AAO39761.1| 712|Apis mellifera transferrin protein. 21 9.8 AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamat... 21 9.8 >DQ015969-1|AAY81926.1| 397|Apis mellifera stargazin related protein STG-1 protein. Length = 397 Score = 23.4 bits (48), Expect = 2.4 Identities = 8/23 (34%), Positives = 13/23 (56%) Frame = +3 Query: 30 NTSKWLIEEQNYASTSSERTARP 98 +T +WL+ E+ TSS + P Sbjct: 72 STGEWLLTEEKLPKTSSNASVEP 94 >AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase protein. Length = 1143 Score = 23.4 bits (48), Expect = 2.4 Identities = 11/33 (33%), Positives = 19/33 (57%) Frame = +1 Query: 685 LSRKLQGSCSCTGECISTDKYVHQLNELLGTQF 783 LSR+++ + E ++ Y +L+ELLG F Sbjct: 464 LSRRIKATVLFATETGTSQMYAEKLSELLGHAF 496 >AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein protein. Length = 1308 Score = 22.2 bits (45), Expect = 5.6 Identities = 9/14 (64%), Positives = 13/14 (92%) Frame = +2 Query: 725 SASALTNMSTNLTS 766 SAS +TN++TNLT+ Sbjct: 952 SASNVTNVTTNLTT 965 >D79208-1|BAA11466.1| 567|Apis mellifera alpha-glucosidase protein. Length = 567 Score = 21.8 bits (44), Expect = 7.4 Identities = 13/28 (46%), Positives = 16/28 (57%), Gaps = 4/28 (14%) Frame = +2 Query: 686 YLASSRDPARAP----ESASALTNMSTN 757 Y SRDPAR P +S SA + S+N Sbjct: 408 YQTMSRDPARTPFQWDDSVSAGFSSSSN 435 >AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. Length = 1946 Score = 21.8 bits (44), Expect = 7.4 Identities = 8/17 (47%), Positives = 10/17 (58%) Frame = -1 Query: 288 PPNRSRYLLPSLSYNHC 238 PPNR +P +YN C Sbjct: 1648 PPNRKLPPVPGSNYNTC 1664 >AB253417-1|BAE86928.1| 567|Apis mellifera alpha-glucosidase protein. Length = 567 Score = 21.8 bits (44), Expect = 7.4 Identities = 13/28 (46%), Positives = 16/28 (57%), Gaps = 4/28 (14%) Frame = +2 Query: 686 YLASSRDPARAP----ESASALTNMSTN 757 Y SRDPAR P +S SA + S+N Sbjct: 408 YQTMSRDPARTPFQWDDSVSAGFSSSSN 435 >AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 646 Score = 21.4 bits (43), Expect = 9.8 Identities = 10/28 (35%), Positives = 14/28 (50%) Frame = +1 Query: 208 EAGASHPGAHAVVIRQRRQEIPGSVRWN 291 + AS PG +V E+PGS W+ Sbjct: 403 DVAASGPGLAFLVYPSAVLELPGSSIWS 430 >AY336529-1|AAQ02340.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 21.4 bits (43), Expect = 9.8 Identities = 8/15 (53%), Positives = 9/15 (60%) Frame = +1 Query: 1 VTYCNRLNRETHRNG 45 VT C N ET+R G Sbjct: 562 VTKCKATNEETYRGG 576 >AY336528-1|AAQ02339.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 21.4 bits (43), Expect = 9.8 Identities = 8/15 (53%), Positives = 9/15 (60%) Frame = +1 Query: 1 VTYCNRLNRETHRNG 45 VT C N ET+R G Sbjct: 562 VTKCKATNEETYRGG 576 >AY217097-1|AAO39761.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 21.4 bits (43), Expect = 9.8 Identities = 8/15 (53%), Positives = 9/15 (60%) Frame = +1 Query: 1 VTYCNRLNRETHRNG 45 VT C N ET+R G Sbjct: 562 VTKCKATNEETYRGG 576 >AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamate receptor protein. Length = 1040 Score = 21.4 bits (43), Expect = 9.8 Identities = 8/10 (80%), Positives = 9/10 (90%) Frame = -3 Query: 604 HPIRLGRRQA 575 HPIR GRRQ+ Sbjct: 82 HPIRHGRRQS 91 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 231,189 Number of Sequences: 438 Number of extensions: 5400 Number of successful extensions: 15 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 14 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 15 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 24639531 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -