BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30633 (735 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecul... 26 0.32 AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member A... 26 0.32 AF213012-1|AAG43568.1| 492|Apis mellifera acetylcholinesterase ... 23 3.9 AB181702-1|BAE06051.1| 628|Apis mellifera acetylcholinesterase ... 23 3.9 AJ547798-1|CAD67999.1| 587|Apis mellifera octopamine receptor p... 22 5.2 AB267886-1|BAF46356.1| 567|Apis mellifera ecdysteroid receptor ... 22 6.9 >AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecule AbsCAM-Ig7B protein. Length = 1923 Score = 26.2 bits (55), Expect = 0.32 Identities = 12/33 (36%), Positives = 17/33 (51%) Frame = +2 Query: 218 VISTVTMHPAGYYANLASGALAAGTIASPWSTP 316 ++ T PAG NL + AL++ I WS P Sbjct: 998 IVRTEPQRPAGPPINLEARALSSSEILITWSPP 1030 >AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member AbsCAM-Ig7A protein. Length = 1919 Score = 26.2 bits (55), Expect = 0.32 Identities = 12/33 (36%), Positives = 17/33 (51%) Frame = +2 Query: 218 VISTVTMHPAGYYANLASGALAAGTIASPWSTP 316 ++ T PAG NL + AL++ I WS P Sbjct: 994 IVRTEPQRPAGPPINLEARALSSSEILITWSPP 1026 >AF213012-1|AAG43568.1| 492|Apis mellifera acetylcholinesterase protein. Length = 492 Score = 22.6 bits (46), Expect = 3.9 Identities = 8/17 (47%), Positives = 12/17 (70%) Frame = +2 Query: 272 GALAAGTIASPWSTPAG 322 G L +GT+ +PWS +G Sbjct: 275 GILQSGTLNAPWSYMSG 291 >AB181702-1|BAE06051.1| 628|Apis mellifera acetylcholinesterase protein. Length = 628 Score = 22.6 bits (46), Expect = 3.9 Identities = 8/17 (47%), Positives = 12/17 (70%) Frame = +2 Query: 272 GALAAGTIASPWSTPAG 322 G L +GT+ +PWS +G Sbjct: 275 GILQSGTLNAPWSYMSG 291 >AJ547798-1|CAD67999.1| 587|Apis mellifera octopamine receptor protein. Length = 587 Score = 22.2 bits (45), Expect = 5.2 Identities = 10/21 (47%), Positives = 12/21 (57%) Frame = +3 Query: 474 TRPVDDAKLFSPTRARCTEGT 536 TRPV ++ SP RAR T Sbjct: 168 TRPVSYPQIMSPRRARLLVAT 188 >AB267886-1|BAF46356.1| 567|Apis mellifera ecdysteroid receptor A isoform protein. Length = 567 Score = 21.8 bits (44), Expect = 6.9 Identities = 12/43 (27%), Positives = 21/43 (48%) Frame = +2 Query: 224 STVTMHPAGYYANLASGALAAGTIASPWSTPAGAPDTNGSGGA 352 +++T+ A +LA + A +P S P G+ +GGA Sbjct: 28 ASLTLVKAETPEHLAGTSTTAAATPTPPSVPVGSAVAGTAGGA 70 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 194,368 Number of Sequences: 438 Number of extensions: 3640 Number of successful extensions: 11 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 22901220 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -