BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30622 (739 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase... 26 0.42 AB267886-1|BAF46356.1| 567|Apis mellifera ecdysteroid receptor ... 24 1.7 AF393494-1|AAL60419.1| 144|Apis mellifera odorant binding prote... 22 6.9 AF166496-1|AAD51944.1| 144|Apis mellifera pheromone-binding pro... 22 6.9 AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamat... 21 9.1 >AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase protein. Length = 1143 Score = 25.8 bits (54), Expect = 0.42 Identities = 13/33 (39%), Positives = 16/33 (48%) Frame = -1 Query: 451 YWHLRRSYIKARPRFGLATVDLFFCSTYNNMIL 353 +WH R + IK RP V LFF N+ L Sbjct: 983 FWHHRLAEIKRRPDLEYGKVWLFFGCRQRNLDL 1015 Score = 23.8 bits (49), Expect = 1.7 Identities = 12/29 (41%), Positives = 16/29 (55%) Frame = -2 Query: 123 FSLKLIHRALLAHMKLKILFPHSTVTNSM 37 F+ KL RAL +K +LF T T+ M Sbjct: 455 FTSKLFGRALSRRIKATVLFATETGTSQM 483 >AB267886-1|BAF46356.1| 567|Apis mellifera ecdysteroid receptor A isoform protein. Length = 567 Score = 23.8 bits (49), Expect = 1.7 Identities = 13/32 (40%), Positives = 16/32 (50%), Gaps = 1/32 (3%) Frame = -3 Query: 227 KDLAGRNVESCFSLAVKQSK-PAVLNVLGSVT 135 + L +N E CFSL K K P L + VT Sbjct: 535 RTLGNQNSEMCFSLKFKNKKLPVFLAEIWDVT 566 >AF393494-1|AAL60419.1| 144|Apis mellifera odorant binding protein ASP1 protein. Length = 144 Score = 21.8 bits (44), Expect = 6.9 Identities = 9/24 (37%), Positives = 13/24 (54%) Frame = -1 Query: 178 NNPSLLCLMFLAV*RFDLLFAEIN 107 N PS+ C M+ + F L+ E N Sbjct: 66 NEPSITCYMYCLLEAFSLVDDEAN 89 >AF166496-1|AAD51944.1| 144|Apis mellifera pheromone-binding protein ASP1 protein. Length = 144 Score = 21.8 bits (44), Expect = 6.9 Identities = 9/24 (37%), Positives = 13/24 (54%) Frame = -1 Query: 178 NNPSLLCLMFLAV*RFDLLFAEIN 107 N PS+ C M+ + F L+ E N Sbjct: 66 NEPSITCYMYCLLEAFSLVDDEAN 89 >AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamate receptor protein. Length = 1040 Score = 21.4 bits (43), Expect = 9.1 Identities = 14/62 (22%), Positives = 23/62 (37%) Frame = +3 Query: 69 KFLISYELTVLYGLISAKSKSNRYTAKNIKHSRLGLFHRETETRLHITPSQIFASI*VNI 248 +F + TV+Y + K+ KHS ++L I +F I +N Sbjct: 725 RFAAGFCFTVVYAALLTKTNRISRIFNASKHSAKRPSFISPRSQLIICSGLVFVQILING 784 Query: 249 TW 254 W Sbjct: 785 VW 786 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 203,128 Number of Sequences: 438 Number of extensions: 4101 Number of successful extensions: 11 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 23023035 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -