BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30620 (675 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 24 1.5 DQ232888-1|ABB36783.1| 499|Apis mellifera cytochrome P450 monoo... 22 6.1 DQ000307-1|AAY21180.1| 423|Apis mellifera major royal jelly pro... 22 6.1 AY127579-1|AAN02286.1| 405|Apis mellifera venom protease precur... 21 8.1 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 23.8 bits (49), Expect = 1.5 Identities = 11/29 (37%), Positives = 16/29 (55%) Frame = -1 Query: 264 PAIFLLLIISTTIPAASRADS*PTRPAAI 178 PA +TT+PAAS + P P+A+ Sbjct: 216 PATVTTTGATTTLPAASATGTGPATPSAV 244 >DQ232888-1|ABB36783.1| 499|Apis mellifera cytochrome P450 monooxygenase protein. Length = 499 Score = 21.8 bits (44), Expect = 6.1 Identities = 10/23 (43%), Positives = 14/23 (60%) Frame = -1 Query: 123 EILCVLAVLFTSSIFMLKAALLF 55 EILC +AVLF + + L + F Sbjct: 6 EILCGIAVLFLALYYYLTSTFDF 28 >DQ000307-1|AAY21180.1| 423|Apis mellifera major royal jelly protein 9 protein. Length = 423 Score = 21.8 bits (44), Expect = 6.1 Identities = 13/32 (40%), Positives = 15/32 (46%) Frame = -2 Query: 413 LIPLFS*SLCCKLHYQPLDRKEP*FQVPERWQ 318 LI FS K HY D K FQV +W+ Sbjct: 8 LILYFSIVCQAKAHYSLRDFKANIFQVKYQWK 39 >AY127579-1|AAN02286.1| 405|Apis mellifera venom protease precursor protein. Length = 405 Score = 21.4 bits (43), Expect = 8.1 Identities = 8/13 (61%), Positives = 9/13 (69%) Frame = -3 Query: 253 LTSYHIYNYPCSL 215 +TSYH N CSL Sbjct: 74 ITSYHRINLKCSL 86 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 188,007 Number of Sequences: 438 Number of extensions: 4066 Number of successful extensions: 8 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 20464920 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -