BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30619 (698 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 08_02_1023 - 23710825-23710950,23711037-23711120,23711367-237114... 77 1e-14 05_06_0020 + 24976990-24977167,24978763-24978874,24979634-249797... 34 0.094 08_01_0033 + 244930-245105,245297-245344,245835-246539,246652-24... 30 1.5 05_07_0009 - 27015346-27015705,27016552-27016676,27016778-270168... 30 2.0 12_01_0818 + 7524549-7524747,7524855-7525863,7525964-7526108,752... 29 3.5 09_06_0055 - 20550889-20551531,20551612-20551889,20552035-205522... 29 3.5 04_04_1374 - 33028790-33028951,33029033-33029087,33029402-330294... 29 3.5 09_02_0203 - 5746068-5746307,5746469-5746729,5746833-5748239,574... 29 4.7 11_01_0515 + 4003167-4003229,4003318-4003738,4004224-4004367,400... 28 6.2 02_05_0702 - 31027908-31027958,31028062-31029311,31029665-310298... 28 6.2 08_01_1049 - 10627636-10628041,10630972-10631115,10631205-106318... 28 8.2 >08_02_1023 - 23710825-23710950,23711037-23711120,23711367-23711492, 23711593-23711712,23712046-23712153,23712243-23712395, 23712505-23712600,23712716-23712800,23713278-23714268, 23714870-23714915,23715806-23715964,23716516-23716651, 23716734-23716900,23717366-23717696,23717827-23718062, 23718326-23718514 Length = 1050 Score = 77.4 bits (182), Expect = 1e-14 Identities = 49/164 (29%), Positives = 89/164 (54%), Gaps = 3/164 (1%) Frame = +2 Query: 89 IKMLDLFSIFSKGGIVLW--CFQSTSEIFSPS-VNALIRSVILQERSGNNTFNHNALTLQ 259 ++ML+ IF++GG++LW C S ++ALIRS +L+ERS + +F+ + L+ Sbjct: 425 VEMLEELLIFTRGGLILWSSCRALGGAALKGSPIDALIRSCLLEERSADASFSQDTYALK 484 Query: 260 YKLDNEFELVFVVAYQRILQLSYVDKFLNDVHLEFRDKYKNELQTGPCIVDFNFKTTFDK 439 + +N+ LVFV YQR+L L YVD L V EF Y + ++ F++ Sbjct: 485 WTFNNDLGLVFVAVYQRMLHLLYVDDLLAAVRKEFSQIYDPKRT--------SYDDAFNE 536 Query: 440 VLKECEIWAKSQAKIPKQMRTFEDSQKSKKTVASMIERKGDEKG 571 V ++ + A+++++ K+ + S+ +K T + +GD +G Sbjct: 537 VFRQLHLEAEARSEEMKKNKQVTGSRPTKVTTKT---NRGDTQG 577 >05_06_0020 + 24976990-24977167,24978763-24978874,24979634-24979722, 24979801-24979869,24979953-24980082,24980506-24980664, 24980767-24981127,24981343-24981452,24981753-24981909, 24983336-24983748,24983828-24984020,24984384-24986198 Length = 1261 Score = 34.3 bits (75), Expect = 0.094 Identities = 23/69 (33%), Positives = 37/69 (53%) Frame = +2 Query: 467 KSQAKIPKQMRTFEDSQKSKKTVASMIERKGDEKGKKTVXIVESKNLTNGKAEEVTNNTY 646 K QAK K R +D ++ +K A ++ER DE I +S L++ +AEEVT Sbjct: 453 KKQAKQKKNNRKIKDKERDEKFEAKILERLHDE-----TAIDDSDGLSSKQAEEVTTKVE 507 Query: 647 DDDVIAANR 673 + + A++R Sbjct: 508 NLEEGASDR 516 >08_01_0033 + 244930-245105,245297-245344,245835-246539,246652-246796, 246893-247240,247882-248721,248786-248832,249470-249596, 249672-249836,249973-251370,251453-251713,251802-252161 Length = 1539 Score = 30.3 bits (65), Expect = 1.5 Identities = 21/54 (38%), Positives = 28/54 (51%) Frame = +2 Query: 368 DKYKNELQTGPCIVDFNFKTTFDKVLKECEIWAKSQAKIPKQMRTFEDSQKSKK 529 DK K+EL G I+D+ + T+DK L E W KS +PK + S K K Sbjct: 1434 DKEKHELVFG--IIDYLRQYTWDKQL---ETWVKSSLVVPKNVSPTVVSPKEYK 1482 >05_07_0009 - 27015346-27015705,27016552-27016676,27016778-27016853, 27016923-27017105,27018000-27018077,27018159-27018239, 27018347-27018412,27018491-27018556,27019126-27019176, 27019286-27019378,27019498-27019625,27019713-27019851, 27021039-27021136,27021332-27021401,27021565-27021654 Length = 567 Score = 29.9 bits (64), Expect = 2.0 Identities = 20/97 (20%), Positives = 41/97 (42%), Gaps = 1/97 (1%) Frame = +2 Query: 320 LSYVDKFLNDVHLEFRDKYKNELQTGPCIVDFNFKTTFDKVLKECEIWAKSQAK-IPKQM 496 L + + L + FR++ N Q G + NFK + +C W ++ + +++ Sbjct: 92 LVVIHRLLREGDPTFREELLNFAQRGRILQLSNFKDDSSPIAWDCSAWVRTYGLFLEERL 151 Query: 497 RTFEDSQKSKKTVASMIERKGDEKGKKTVXIVESKNL 607 F + + + +G EKG +ES++L Sbjct: 152 ECFRVLKYDVEAERLSKQGQGPEKGHSRTRELESQDL 188 >12_01_0818 + 7524549-7524747,7524855-7525863,7525964-7526108, 7526206-7526295,7526404-7526553,7527333-7528094, 7528177-7528496,7528581-7528707,7528792-7528959, 7529054-7530466,7530563-7530823,7530983-7531144, 7531976-7532121,7532601-7532667,7533483-7533587 Length = 1707 Score = 29.1 bits (62), Expect = 3.5 Identities = 19/52 (36%), Positives = 27/52 (51%) Frame = +2 Query: 368 DKYKNELQTGPCIVDFNFKTTFDKVLKECEIWAKSQAKIPKQMRTFEDSQKS 523 DK K EL G I+D+ + T+DK L E W K+ +PK + S K+ Sbjct: 1562 DKQKKELVFG--IIDYLRQYTWDKQL---ESWVKTSLFVPKNLSPTVSSPKT 1608 >09_06_0055 - 20550889-20551531,20551612-20551889,20552035-20552203, 20552397-20552534,20553945-20553997,20554521-20554574, 20556062-20556295,20556399-20556986,20557065-20557419, 20557494-20557694,20557925-20557998,20558114-20558254, 20558611-20558670,20558750-20558806,20559281-20559318, 20559419-20559578 Length = 1080 Score = 29.1 bits (62), Expect = 3.5 Identities = 19/77 (24%), Positives = 37/77 (48%), Gaps = 1/77 (1%) Frame = +2 Query: 464 AKSQAKIPKQMRTFEDSQKSKKTVASMIERKGDEKG-KKTVXIVESKNLTNGKAEEVTNN 640 A+ +A + M + S +S+ +A +++ G ++T IV G ++E+T Sbjct: 996 AQLRAVVETAMLCTQSSAESRPAMAEVVDMLRFSGGERRTKEIVPVAATVAGSSDEITMT 1055 Query: 641 TYDDDVIAANRAKLAQK 691 T DDV A + L ++ Sbjct: 1056 TDQDDVTAGSSEPLDRR 1072 >04_04_1374 - 33028790-33028951,33029033-33029087,33029402-33029466, 33029558-33029701,33029825-33029878,33029971-33030220, 33030340-33030446,33031206-33031216,33032682-33032796, 33032897-33033005,33033088-33033203,33033288-33033647 Length = 515 Score = 29.1 bits (62), Expect = 3.5 Identities = 27/88 (30%), Positives = 41/88 (46%), Gaps = 6/88 (6%) Frame = +2 Query: 329 VDKFLNDVHLEFRDKYKNELQTGPCIVDFNFKTT-----FDKVLKECEIWAKSQAKIPKQ 493 VDK +ND E + K +N + + D N K T + + LKE E ++Q K+ Sbjct: 395 VDKAVNDKSKEIQQKIENAMLEKKKLADMNEKLTKNQDIWRRTLKEIEERERAQLKLKDD 454 Query: 494 -MRTFEDSQKSKKTVASMIERKGDEKGK 574 +R E+ K K S+ +K EK K Sbjct: 455 TIRDLEEQIKDFK--FSIKLQKSIEKNK 480 >09_02_0203 - 5746068-5746307,5746469-5746729,5746833-5748239, 5748588-5748714,5748800-5749119,5749202-5749963, 5750749-5750898,5751007-5751096,5751196-5751340, 5751440-5751617,5751753-5752448,5752555-5752753 Length = 1524 Score = 28.7 bits (61), Expect = 4.7 Identities = 20/54 (37%), Positives = 27/54 (50%) Frame = +2 Query: 368 DKYKNELQTGPCIVDFNFKTTFDKVLKECEIWAKSQAKIPKQMRTFEDSQKSKK 529 DK K EL G I+D+ + T+DK L E W K+ +PK + S K K Sbjct: 1459 DKQKKELVFG--IIDYLRQYTWDKQL---ESWVKTSLFVPKNLSPTVISPKEYK 1507 >11_01_0515 + 4003167-4003229,4003318-4003738,4004224-4004367, 4004474-4004556,4004661-4004775,4005309-4005400, 4005558-4005612,4005689-4005834,4005888-4006001, 4006149-4006342,4006985-4007112,4008526-4008583, 4009800-4009876,4010214-4010263,4010336-4010515, 4010633-4010731,4010816-4011133,4011221-4011281, 4011693-4012781,4012951-4013005,4013133-4013291, 4013923-4014442 Length = 1406 Score = 28.3 bits (60), Expect = 6.2 Identities = 12/34 (35%), Positives = 18/34 (52%), Gaps = 1/34 (2%) Frame = -3 Query: 522 DFWESSKVLI-CFGILACDFAHISHSFSTLSKVV 424 DFW+ S V F + CD + HSF T + ++ Sbjct: 731 DFWKPSLVTFPSFQVSPCDIYRVPHSFRTTNMLI 764 >02_05_0702 - 31027908-31027958,31028062-31029311,31029665-31029842, 31029955-31030017,31031597-31031704,31031772-31031836, 31031928-31032015,31032104-31032157,31032234-31032380, 31033358-31033429,31034077-31034226,31034317-31034430, 31034762-31034875,31035925-31036077,31037437-31037529, 31038202-31038318,31038984-31039086,31039192-31039376, 31039448-31039522,31040451-31040534,31041547-31041588, 31041668-31041847,31042109-31042162,31042239-31042280, 31042869-31042967,31043040-31043174,31043325-31043427, 31045061-31045134,31045227-31045270,31045393-31045471, 31045592-31045705,31045842-31045946,31046027-31046161, 31046447-31046546,31046870-31046883,31046936-31047004, 31047079-31047182,31047299-31047347,31047931-31048023, 31048102-31048210,31048619-31048755,31048851-31048928, 31049015-31049104,31049402-31049467,31049546-31049638, 31049711-31049839,31050024-31050122,31051366-31051512, 31051605-31051910 Length = 2050 Score = 28.3 bits (60), Expect = 6.2 Identities = 18/69 (26%), Positives = 30/69 (43%) Frame = +2 Query: 317 QLSYVDKFLNDVHLEFRDKYKNELQTGPCIVDFNFKTTFDKVLKECEIWAKSQAKIPKQM 496 +L +K LNDV + + + ++ N K D KE E K + + KQ+ Sbjct: 1420 ELDAREKKLNDVEASLKSEIDRHRK-----ININIKRKLDASAKEKEELTKEKQSLSKQL 1474 Query: 497 RTFEDSQKS 523 + SQK+ Sbjct: 1475 EDLKSSQKT 1483 >08_01_1049 - 10627636-10628041,10630972-10631115,10631205-10631869, 10632709-10633110 Length = 538 Score = 27.9 bits (59), Expect = 8.2 Identities = 14/38 (36%), Positives = 20/38 (52%) Frame = +2 Query: 515 QKSKKTVASMIERKGDEKGKKTVXIVESKNLTNGKAEE 628 +K K+T + E G+EK K V +VE+K G E Sbjct: 76 EKEKETKVKVKEEGGEEKEKGKVEVVEAKRRPAGVGAE 113 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,006,155 Number of Sequences: 37544 Number of extensions: 291898 Number of successful extensions: 702 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 682 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 701 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1792053856 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -