BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30618 (700 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC1A6.11 |||dubious|Schizosaccharomyces pombe|chr 1|||Manual 26 4.5 SPAC3C7.01c ||SPAC732.03c|inositol polyphosphate phosphatase |Sc... 26 6.0 SPBPB2B2.08 |||conserved fungal protein|Schizosaccharomyces pomb... 25 7.9 >SPAC1A6.11 |||dubious|Schizosaccharomyces pombe|chr 1|||Manual Length = 106 Score = 26.2 bits (55), Expect = 4.5 Identities = 10/35 (28%), Positives = 19/35 (54%) Frame = -2 Query: 696 ILFANYLYNALLHCDDSLIVLHPFEYGSFTYLYPC 592 ++ + +++ L C+ +L +LH SF YL C Sbjct: 43 LMTSQHIFKCLSSCNYALSILHNICLASFLYLSKC 77 >SPAC3C7.01c ||SPAC732.03c|inositol polyphosphate phosphatase |Schizosaccharomyces pombe|chr 1|||Manual Length = 611 Score = 25.8 bits (54), Expect = 6.0 Identities = 11/20 (55%), Positives = 15/20 (75%) Frame = -3 Query: 257 FKFRHHFKNMTQK*IIFRLL 198 F FR+HF+N+T K +FR L Sbjct: 585 FSFRNHFRNITLK--VFRFL 602 >SPBPB2B2.08 |||conserved fungal protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 220 Score = 25.4 bits (53), Expect = 7.9 Identities = 10/21 (47%), Positives = 12/21 (57%) Frame = +2 Query: 8 SGSWHRSGYSLSFGWYRNLWK 70 +G HR G GWY+N WK Sbjct: 180 AGKIHREGLKAVRGWYKN-WK 199 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,804,458 Number of Sequences: 5004 Number of extensions: 56083 Number of successful extensions: 147 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 133 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 147 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 323158234 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -