BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30615 (603 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U33463-1|AAC47095.1| 345|Drosophila melanogaster transposase pr... 38 0.008 X67681-1|CAA47913.1| 339|Drosophila melanogaster ORF protein. 33 0.23 >U33463-1|AAC47095.1| 345|Drosophila melanogaster transposase protein. Length = 345 Score = 38.3 bits (85), Expect = 0.008 Identities = 17/46 (36%), Positives = 26/46 (56%) Frame = -1 Query: 597 KTWLLAKSISTIEXPSNSPDLSQIESLWWKMKKVLRKYPSRSKSDL 460 + WLL I+ P SPDL+ IE+LW +KK + K +++ L Sbjct: 259 RNWLLYNCGKVIDTPPQSPDLNPIENLWAYLKKKVAKRGPKTRQQL 304 >X67681-1|CAA47913.1| 339|Drosophila melanogaster ORF protein. Length = 339 Score = 33.5 bits (73), Expect = 0.23 Identities = 13/38 (34%), Positives = 24/38 (63%) Frame = -3 Query: 454 KLLAVWESIKPEECAALVATMPLRIKAVIESKGDTTKW 341 ++ +W + E LV ++P R++AVI++KG TK+ Sbjct: 302 EIAEIWSKLTLEFAQTLVRSIPKRLQAVIDAKGGVTKY 339 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,379,048 Number of Sequences: 53049 Number of extensions: 391178 Number of successful extensions: 915 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 892 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 915 length of database: 24,988,368 effective HSP length: 81 effective length of database: 20,691,399 effective search space used: 2462276481 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -