BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30610 (590 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB264333-1|BAF44088.1| 36|Apis mellifera ecdysone-induced prot... 23 3.0 DQ325075-1|ABD14089.1| 181|Apis mellifera complementary sex det... 21 6.8 DQ325074-1|ABD14088.1| 181|Apis mellifera complementary sex det... 21 6.8 DQ325073-1|ABD14087.1| 181|Apis mellifera complementary sex det... 21 6.8 DQ325072-1|ABD14086.1| 181|Apis mellifera complementary sex det... 21 6.8 DQ325071-1|ABD14085.1| 181|Apis mellifera complementary sex det... 21 6.8 DQ325070-1|ABD14084.1| 181|Apis mellifera complementary sex det... 21 6.8 DQ325069-1|ABD14083.1| 181|Apis mellifera complementary sex det... 21 6.8 DQ325068-1|ABD14082.1| 181|Apis mellifera complementary sex det... 21 6.8 AY569696-1|AAS86649.1| 414|Apis mellifera complementary sex det... 21 6.8 AY569695-1|AAS86648.1| 414|Apis mellifera complementary sex det... 21 6.8 AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. 21 6.8 DQ342041-1|ABC69933.1| 828|Apis mellifera STIP protein. 21 9.0 >AB264333-1|BAF44088.1| 36|Apis mellifera ecdysone-induced protein 75 protein. Length = 36 Score = 22.6 bits (46), Expect = 3.0 Identities = 7/22 (31%), Positives = 13/22 (59%) Frame = +1 Query: 229 YYSSLPSHIKVNLPALSPTMES 294 + + LP H+ N+P + T+ S Sbjct: 6 HVAQLPHHLSPNMPTMDSTVSS 27 >DQ325075-1|ABD14089.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.4 bits (43), Expect = 6.8 Identities = 7/34 (20%), Positives = 19/34 (55%) Frame = +3 Query: 27 LVKNIDNVANNCVTESNLKRWS*ESYTVEYYEVH 128 ++ N ++++NN +N ++ +Y YY ++ Sbjct: 81 IISNNNSLSNNYNYNNNYNNYNKHNYNKLYYNIN 114 >DQ325074-1|ABD14088.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.4 bits (43), Expect = 6.8 Identities = 7/34 (20%), Positives = 19/34 (55%) Frame = +3 Query: 27 LVKNIDNVANNCVTESNLKRWS*ESYTVEYYEVH 128 ++ N ++++NN +N ++ +Y YY ++ Sbjct: 81 IISNNNSLSNNYNYNNNYNNYNKHNYNKLYYNIN 114 >DQ325073-1|ABD14087.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.4 bits (43), Expect = 6.8 Identities = 7/34 (20%), Positives = 19/34 (55%) Frame = +3 Query: 27 LVKNIDNVANNCVTESNLKRWS*ESYTVEYYEVH 128 ++ N ++++NN +N ++ +Y YY ++ Sbjct: 81 IISNNNSLSNNYNYNNNYNNYNKHNYNKLYYNIN 114 >DQ325072-1|ABD14086.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.4 bits (43), Expect = 6.8 Identities = 7/34 (20%), Positives = 19/34 (55%) Frame = +3 Query: 27 LVKNIDNVANNCVTESNLKRWS*ESYTVEYYEVH 128 ++ N ++++NN +N ++ +Y YY ++ Sbjct: 81 IISNNNSLSNNYNYNNNYNNYNKHNYNKLYYNIN 114 >DQ325071-1|ABD14085.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.4 bits (43), Expect = 6.8 Identities = 7/34 (20%), Positives = 19/34 (55%) Frame = +3 Query: 27 LVKNIDNVANNCVTESNLKRWS*ESYTVEYYEVH 128 ++ N ++++NN +N ++ +Y YY ++ Sbjct: 81 IISNNNSLSNNYNYNNNYNNYNKHNYNKLYYNIN 114 >DQ325070-1|ABD14084.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.4 bits (43), Expect = 6.8 Identities = 7/34 (20%), Positives = 19/34 (55%) Frame = +3 Query: 27 LVKNIDNVANNCVTESNLKRWS*ESYTVEYYEVH 128 ++ N ++++NN +N ++ +Y YY ++ Sbjct: 81 IISNNNSLSNNYNYNNNYNNYNKHNYNKLYYNIN 114 >DQ325069-1|ABD14083.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.4 bits (43), Expect = 6.8 Identities = 7/34 (20%), Positives = 19/34 (55%) Frame = +3 Query: 27 LVKNIDNVANNCVTESNLKRWS*ESYTVEYYEVH 128 ++ N ++++NN +N ++ +Y YY ++ Sbjct: 81 IISNNNSLSNNYNYNNNYNNYNKHNYNKLYYNIN 114 >DQ325068-1|ABD14082.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.4 bits (43), Expect = 6.8 Identities = 7/34 (20%), Positives = 19/34 (55%) Frame = +3 Query: 27 LVKNIDNVANNCVTESNLKRWS*ESYTVEYYEVH 128 ++ N ++++NN +N ++ +Y YY ++ Sbjct: 81 IISNNNSLSNNYNYNNNYNNYNKHNYNKLYYNIN 114 >AY569696-1|AAS86649.1| 414|Apis mellifera complementary sex determiner protein. Length = 414 Score = 21.4 bits (43), Expect = 6.8 Identities = 7/34 (20%), Positives = 19/34 (55%) Frame = +3 Query: 27 LVKNIDNVANNCVTESNLKRWS*ESYTVEYYEVH 128 ++ N ++++NN +N ++ +Y YY ++ Sbjct: 314 IISNNNSLSNNYNYNNNYNNYNKHNYNKLYYNIN 347 >AY569695-1|AAS86648.1| 414|Apis mellifera complementary sex determiner protein. Length = 414 Score = 21.4 bits (43), Expect = 6.8 Identities = 7/34 (20%), Positives = 19/34 (55%) Frame = +3 Query: 27 LVKNIDNVANNCVTESNLKRWS*ESYTVEYYEVH 128 ++ N ++++NN +N ++ +Y YY ++ Sbjct: 314 IISNNNSLSNNYNYNNNYNNYNKHNYNKLYYNIN 347 >AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. Length = 735 Score = 21.4 bits (43), Expect = 6.8 Identities = 8/23 (34%), Positives = 13/23 (56%) Frame = +2 Query: 479 LEIRMMLRHSKISKMTHHLQHLK 547 LEI++ +++ M HHL K Sbjct: 326 LEIQLQKERDRLTAMMHHLHVAK 348 >DQ342041-1|ABC69933.1| 828|Apis mellifera STIP protein. Length = 828 Score = 21.0 bits (42), Expect = 9.0 Identities = 11/39 (28%), Positives = 16/39 (41%) Frame = +1 Query: 151 KVTNKLLEYTQNQAVLSVPQWTVQMRYYSSLPSHIKVNL 267 K+ L E+ N + QW + +PSHI L Sbjct: 607 KLQIALSEFVINPHQQHLDQWNWVYEWKELIPSHIMAGL 645 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 170,751 Number of Sequences: 438 Number of extensions: 3663 Number of successful extensions: 15 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 15 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 15 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 17237673 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -