BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30604 (669 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z81547-1|CAB04459.1| 354|Caenorhabditis elegans Hypothetical pr... 30 1.3 Z75545-6|CAA99888.3| 649|Caenorhabditis elegans Hypothetical pr... 29 3.9 U40061-5|AAY43979.1| 312|Caenorhabditis elegans Hypothetical pr... 29 3.9 AL008986-2|CAA15621.3| 649|Caenorhabditis elegans Hypothetical ... 29 3.9 >Z81547-1|CAB04459.1| 354|Caenorhabditis elegans Hypothetical protein F53F8.1 protein. Length = 354 Score = 30.3 bits (65), Expect = 1.3 Identities = 18/39 (46%), Positives = 23/39 (58%) Frame = +2 Query: 377 SSFIYLYYLGGTNDKTNYKFNICYFMTHS*LSGNFLPLF 493 SSF+Y +LGG K+ KF++CY S SG PLF Sbjct: 8 SSFLYFLFLGGK--KSLLKFSVCYH--RSDRSGVTTPLF 42 >Z75545-6|CAA99888.3| 649|Caenorhabditis elegans Hypothetical protein H37N21.1 protein. Length = 649 Score = 28.7 bits (61), Expect = 3.9 Identities = 19/67 (28%), Positives = 31/67 (46%) Frame = +2 Query: 152 IIFEITVIYIQSNLDKRELDK*ENSISESNSQGPSL*APKTSISEKQKPL*ERVVSPSWT 331 + F+I I + + E E S ESNS+ P +SI+ KP+ + V S T Sbjct: 586 VAFDIRAARIAEGVQEEEN---ETSTRESNSEAPIENGTSSSITNSVKPIVDSVAPSSQT 642 Query: 332 SVSETAT 352 + T++ Sbjct: 643 PTTTTSS 649 >U40061-5|AAY43979.1| 312|Caenorhabditis elegans Hypothetical protein ZK563.7 protein. Length = 312 Score = 28.7 bits (61), Expect = 3.9 Identities = 14/39 (35%), Positives = 20/39 (51%) Frame = +2 Query: 323 SWTSVSETATYLYLYKRQSSFIYLYYLGGTNDKTNYKFN 439 SW S + R +SFI+ +LGG N +N+ FN Sbjct: 20 SWYSTLRYGALAFSQNRTASFIH--WLGGVNITSNFNFN 56 >AL008986-2|CAA15621.3| 649|Caenorhabditis elegans Hypothetical protein H37N21.1 protein. Length = 649 Score = 28.7 bits (61), Expect = 3.9 Identities = 19/67 (28%), Positives = 31/67 (46%) Frame = +2 Query: 152 IIFEITVIYIQSNLDKRELDK*ENSISESNSQGPSL*APKTSISEKQKPL*ERVVSPSWT 331 + F+I I + + E E S ESNS+ P +SI+ KP+ + V S T Sbjct: 586 VAFDIRAARIAEGVQEEEN---ETSTRESNSEAPIENGTSSSITNSVKPIVDSVAPSSQT 642 Query: 332 SVSETAT 352 + T++ Sbjct: 643 PTTTTSS 649 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,942,121 Number of Sequences: 27780 Number of extensions: 307303 Number of successful extensions: 597 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 586 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 596 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1508017654 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -