BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30593 (728 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF002238-1|AAB97731.1| 327|Anopheles gambiae ribosomal protein ... 27 0.59 AB090823-2|BAC57922.1| 1154|Anopheles gambiae reverse transcript... 25 1.8 AJ301655-1|CAC35008.1| 1433|Anopheles gambiae putative epidermal... 25 2.4 >AF002238-1|AAB97731.1| 327|Anopheles gambiae ribosomal protein L5 protein. Length = 327 Score = 27.1 bits (57), Expect = 0.59 Identities = 12/21 (57%), Positives = 13/21 (61%) Frame = +3 Query: 48 RHSTRSTCPTSWHSVRSTSTP 110 R +RST PTSW R TS P Sbjct: 277 RRRSRSTRPTSWPRSRPTSKP 297 >AB090823-2|BAC57922.1| 1154|Anopheles gambiae reverse transcriptase protein. Length = 1154 Score = 25.4 bits (53), Expect = 1.8 Identities = 13/44 (29%), Positives = 20/44 (45%), Gaps = 2/44 (4%) Frame = +1 Query: 175 PDGPARGERCY--RRKRDNL*GLRRYFGSGRHTERSRRAGHQKR 300 PD P + Y RR R ++R +GR + RR H+ + Sbjct: 532 PDSPRLSDAQYGFRRGRSTFSAIQRVVDAGRRAKSFRRTNHRDK 575 >AJ301655-1|CAC35008.1| 1433|Anopheles gambiae putative epidermal growth factor receptorprotein. Length = 1433 Score = 25.0 bits (52), Expect = 2.4 Identities = 13/48 (27%), Positives = 23/48 (47%) Frame = +2 Query: 200 AVIEENEIIYRDYVDISVAVATPKGLVVPVIRNVQNMTYADIELTIAG 343 A +EE +++RD +V V TP + + V + + + E AG Sbjct: 948 AYLEERRLVHRDLAARNVLVQTPSCVKITVFGLAKLLDFDSDEYRAAG 995 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 755,248 Number of Sequences: 2352 Number of extensions: 15248 Number of successful extensions: 41 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 41 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 41 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 74428737 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -