BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30590 (710 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ257415-1|ABB81846.1| 430|Apis mellifera yellow-like protein p... 23 2.2 AB204559-1|BAD89804.1| 832|Apis mellifera soluble guanylyl cycl... 23 2.9 DQ325115-1|ABD14129.1| 185|Apis mellifera complementary sex det... 22 5.0 DQ325133-1|ABD14147.1| 181|Apis mellifera complementary sex det... 22 6.6 AJ849455-1|CAH60991.1| 366|Apis mellifera twist protein protein. 21 8.7 >DQ257415-1|ABB81846.1| 430|Apis mellifera yellow-like protein protein. Length = 430 Score = 23.4 bits (48), Expect = 2.2 Identities = 11/33 (33%), Positives = 16/33 (48%) Frame = +3 Query: 465 HFMTSRSGAWSETLSPLVVNGLTLSSMVPRASR 563 +F G + +LSP+ VNG P +SR Sbjct: 250 NFQWGEEGIFGMSLSPIAVNGYRTLFFHPLSSR 282 >AB204559-1|BAD89804.1| 832|Apis mellifera soluble guanylyl cyclase beta-3 protein. Length = 832 Score = 23.0 bits (47), Expect = 2.9 Identities = 9/27 (33%), Positives = 15/27 (55%) Frame = +1 Query: 286 GHSEGCSHQTQ*AGGRVRPRHGPTKHR 366 G+S+ +HQ Q G + G T+H+ Sbjct: 799 GNSQSLAHQDQCCPGFTMTKSGKTRHQ 825 >DQ325115-1|ABD14129.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 22.2 bits (45), Expect = 5.0 Identities = 7/17 (41%), Positives = 11/17 (64%) Frame = +2 Query: 554 SFKDNPDTYNPKYNTKY 604 ++ +N + YN YNT Y Sbjct: 93 NYNNNYNNYNNNYNTNY 109 >DQ325133-1|ABD14147.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.8 bits (44), Expect = 6.6 Identities = 8/20 (40%), Positives = 10/20 (50%) Frame = +2 Query: 563 DNPDTYNPKYNTKYGMYKPH 622 +NP + N YN Y Y H Sbjct: 85 NNPLSNNYNYNNNYNNYNKH 104 >AJ849455-1|CAH60991.1| 366|Apis mellifera twist protein protein. Length = 366 Score = 21.4 bits (43), Expect = 8.7 Identities = 8/21 (38%), Positives = 11/21 (52%) Frame = +2 Query: 530 DSIVYGPESFKDNPDTYNPKY 592 DS+ Y PE + PD +Y Sbjct: 168 DSVEYKPEIMEYKPDVEEQRY 188 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 191,820 Number of Sequences: 438 Number of extensions: 4320 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 21926700 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -