BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30587 (646 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 27 0.21 AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. 23 2.5 Y13429-1|CAA73841.1| 402|Apis mellifera dopamine receptor, D1 p... 21 7.7 DQ666693-1|ABG29167.1| 250|Apis mellifera MAX dimerization prot... 21 7.7 AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. 21 7.7 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 26.6 bits (56), Expect = 0.21 Identities = 14/57 (24%), Positives = 26/57 (45%) Frame = -3 Query: 428 ESEEQQERHHKTEQTHSLRQGETQNGV*EQLLLEGGVPGIADDEGAEDCSNTSSGTS 258 + ++QQ+R + ++ LR E + V E GG G+ D S ++ T+ Sbjct: 165 QQQQQQQRQQQRQEERRLRPDEIKVEVGEDEFANGGAARDESKAGSTDASTPATVTT 221 >AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. Length = 735 Score = 23.0 bits (47), Expect = 2.5 Identities = 9/28 (32%), Positives = 19/28 (67%), Gaps = 1/28 (3%) Frame = -3 Query: 449 FLKVNSLESEEQQERHHK-TEQTHSLRQ 369 F++ +SL ++QQ++HH+ + H+ Q Sbjct: 91 FMQQHSLYLQQQQQQHHQDSSSEHASNQ 118 Score = 21.8 bits (44), Expect = 5.8 Identities = 7/17 (41%), Positives = 10/17 (58%) Frame = -2 Query: 51 WRQTAFCFYKVRRATTK 1 W Q FC+++ AT K Sbjct: 533 WFQNTFCYFRRNAATWK 549 >Y13429-1|CAA73841.1| 402|Apis mellifera dopamine receptor, D1 protein. Length = 402 Score = 21.4 bits (43), Expect = 7.7 Identities = 8/28 (28%), Positives = 17/28 (60%) Frame = +1 Query: 145 LLSLHSSLQCGPSRPHRSLRTLTLLPNS 228 +L ++ L C + +S+R +T LP++ Sbjct: 208 MLGIYCRLYCYAQKHVKSIRAVTKLPDT 235 >DQ666693-1|ABG29167.1| 250|Apis mellifera MAX dimerization protein protein. Length = 250 Score = 21.4 bits (43), Expect = 7.7 Identities = 15/59 (25%), Positives = 29/59 (49%), Gaps = 1/59 (1%) Frame = -3 Query: 431 LESEEQQERHHKTEQTHSLRQGETQNGV*EQLLLEGGVPGIADDEGAEDCSNTS-SGTS 258 ++S E++ER H + R+ EQL + G+ G+ G S+++ +G+S Sbjct: 97 IKSLEERERKHAVHKEQLSREQRFLRRRLEQLTNQTGLHGLHGLHGLHGLSSSAPTGSS 155 >AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. Length = 1946 Score = 21.4 bits (43), Expect = 7.7 Identities = 7/11 (63%), Positives = 9/11 (81%), Gaps = 1/11 (9%) Frame = +1 Query: 115 QQYP-PIHRWY 144 Q +P P+HRWY Sbjct: 237 QGFPVPVHRWY 247 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 185,476 Number of Sequences: 438 Number of extensions: 4069 Number of successful extensions: 12 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 19438227 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -