BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30576 (663 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAPB15E9.02c |||dubious|Schizosaccharomyces pombe|chr 1|||Manual 25 7.4 SPAC12G12.16c ||SPAC18B11.01c|nuclease, XP-G family|Schizosaccha... 25 9.7 >SPAPB15E9.02c |||dubious|Schizosaccharomyces pombe|chr 1|||Manual Length = 188 Score = 25.4 bits (53), Expect = 7.4 Identities = 16/59 (27%), Positives = 28/59 (47%), Gaps = 5/59 (8%) Frame = -1 Query: 645 SFFLHIYFR*AFSCKFFYSIFYRY-----KAFSYIEEKYIVSRSKLKNFRFHVKNKKTF 484 S F ++FR F C FF+ + Y + AF ++ +VS S+ + + + TF Sbjct: 12 SSFESLFFRLFFVCSFFFPLLYSFIFATLHAFVFLFSHTLVS-SQFRRLKLPYHHHHTF 69 >SPAC12G12.16c ||SPAC18B11.01c|nuclease, XP-G family|Schizosaccharomyces pombe|chr 1|||Manual Length = 496 Score = 25.0 bits (52), Expect = 9.7 Identities = 15/45 (33%), Positives = 25/45 (55%) Frame = -1 Query: 603 KFFYSIFYRYKAFSYIEEKYIVSRSKLKNFRFHVKNKKTFHSLPT 469 +++ + F KA + +EEKYI+ +K F + KK F LP+ Sbjct: 393 RYYGNAFDVLKALN-VEEKYIIPTDYIKKF---LTAKKLFTDLPS 433 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,176,925 Number of Sequences: 5004 Number of extensions: 41156 Number of successful extensions: 85 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 84 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 85 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 301829700 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -