BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30543 (640 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF067608-1|AAC17654.2| 544|Caenorhabditis elegans Hypothetical ... 28 6.5 AF106577-16|AAC78188.1| 369|Caenorhabditis elegans Hypothetical... 27 8.6 >AF067608-1|AAC17654.2| 544|Caenorhabditis elegans Hypothetical protein B0511.6 protein. Length = 544 Score = 27.9 bits (59), Expect = 6.5 Identities = 14/36 (38%), Positives = 22/36 (61%) Frame = -1 Query: 325 LVLIAMYPQK*SKSRHLMVFFLECNSALNTHTRLRY 218 L+L+ + +K +K++ +MVFF CNS H L Y Sbjct: 302 LLLLFTFLKK-NKTKKVMVFFSSCNSVKFHHELLNY 336 >AF106577-16|AAC78188.1| 369|Caenorhabditis elegans Hypothetical protein F46F5.10 protein. Length = 369 Score = 27.5 bits (58), Expect = 8.6 Identities = 11/31 (35%), Positives = 17/31 (54%) Frame = -2 Query: 546 SVVWYKF*MNIWIVPRKLKQRYQQLFLVYNN 454 S VW+ N W+ P+ L Y+++ YNN Sbjct: 204 SNVWWLDAHNRWLQPKPLSYMYEEMAQCYNN 234 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,673,183 Number of Sequences: 27780 Number of extensions: 272891 Number of successful extensions: 551 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 548 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 551 length of database: 12,740,198 effective HSP length: 78 effective length of database: 10,573,358 effective search space used: 1416829972 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -