BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30514 (740 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AL359273-3|CAH73123.1| 102|Homo sapiens dnaj-like protein (LOC1... 30 7.6 AL359273-2|CAH73122.1| 122|Homo sapiens dnaj-like protein (LOC1... 30 7.6 AL359273-1|CAH73121.1| 116|Homo sapiens dnaj-like protein (LOC1... 30 7.6 >AL359273-3|CAH73123.1| 102|Homo sapiens dnaj-like protein (LOC148418) protein. Length = 102 Score = 30.3 bits (65), Expect = 7.6 Identities = 15/38 (39%), Positives = 25/38 (65%) Frame = -3 Query: 675 ILL*KTDNVTGKKLKLNVAKMISIQKYHIKPLKHSPVK 562 +L+ + D +TG +LKL A + I +YH+KPL+ +K Sbjct: 63 LLMTRNDVLTGLQLKLGPA--LKIYEYHVKPLQTKHLK 98 >AL359273-2|CAH73122.1| 122|Homo sapiens dnaj-like protein (LOC148418) protein. Length = 122 Score = 30.3 bits (65), Expect = 7.6 Identities = 15/38 (39%), Positives = 25/38 (65%) Frame = -3 Query: 675 ILL*KTDNVTGKKLKLNVAKMISIQKYHIKPLKHSPVK 562 +L+ + D +TG +LKL A + I +YH+KPL+ +K Sbjct: 83 LLMTRNDVLTGLQLKLGPA--LKIYEYHVKPLQTKHLK 118 >AL359273-1|CAH73121.1| 116|Homo sapiens dnaj-like protein (LOC148418) protein. Length = 116 Score = 30.3 bits (65), Expect = 7.6 Identities = 15/38 (39%), Positives = 25/38 (65%) Frame = -3 Query: 675 ILL*KTDNVTGKKLKLNVAKMISIQKYHIKPLKHSPVK 562 +L+ + D +TG +LKL A + I +YH+KPL+ +K Sbjct: 77 LLMTRNDVLTGLQLKLGPA--LKIYEYHVKPLQTKHLK 112 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 77,006,742 Number of Sequences: 237096 Number of extensions: 1224775 Number of successful extensions: 1896 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1869 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1896 length of database: 76,859,062 effective HSP length: 88 effective length of database: 55,994,614 effective search space used: 8847149012 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -