BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30509 (460 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_57166| Best HMM Match : 7tm_1 (HMM E-Value=2.2e-25) 29 1.8 SB_45817| Best HMM Match : Ank (HMM E-Value=0) 28 4.3 SB_19339| Best HMM Match : Transposase_21 (HMM E-Value=5.6e-05) 28 4.3 SB_34331| Best HMM Match : Transposase_21 (HMM E-Value=0.00032) 28 4.3 SB_5195| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.9 >SB_57166| Best HMM Match : 7tm_1 (HMM E-Value=2.2e-25) Length = 382 Score = 29.1 bits (62), Expect = 1.8 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = +2 Query: 104 ALAKSWCYNFMHYLLPQYGTWXVKHVGH 187 ALA WC N ++Y L +G W + + H Sbjct: 265 ALAVCWCPNQVYYALYNFGAWELNNNVH 292 >SB_45817| Best HMM Match : Ank (HMM E-Value=0) Length = 417 Score = 27.9 bits (59), Expect = 4.3 Identities = 18/62 (29%), Positives = 25/62 (40%) Frame = +2 Query: 20 KGKTLNIASC*TEHGQFAEHVNKTGCIAALAKSWCYNFMHYLLPQYGTWXVKHVGHLMDQ 199 KG T + EH EH NK GC + + F +L GT+ +L+D Sbjct: 312 KGHT-KVVELLLEHKSNIEHRNKAGCTPLMLAARAMRFRVAILTVLGTYNDGRNANLIDM 370 Query: 200 LF 205 F Sbjct: 371 NF 372 >SB_19339| Best HMM Match : Transposase_21 (HMM E-Value=5.6e-05) Length = 290 Score = 27.9 bits (59), Expect = 4.3 Identities = 10/19 (52%), Positives = 13/19 (68%) Frame = +3 Query: 132 SCITCYLNTARGKSSTWDT 188 +C+ C + A GKS TWDT Sbjct: 28 NCVHCKKSFAPGKSKTWDT 46 >SB_34331| Best HMM Match : Transposase_21 (HMM E-Value=0.00032) Length = 276 Score = 27.9 bits (59), Expect = 4.3 Identities = 10/19 (52%), Positives = 13/19 (68%) Frame = +3 Query: 132 SCITCYLNTARGKSSTWDT 188 +C+ C + A GKS TWDT Sbjct: 28 NCVHCKKSFAPGKSKTWDT 46 >SB_5195| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 542 Score = 26.6 bits (56), Expect = 9.9 Identities = 12/33 (36%), Positives = 18/33 (54%) Frame = +1 Query: 193 GSTIYCRLLTSAYQWLAYKSSSFFISCNITKRF 291 G ++C LL A +AY S +F + C T+ F Sbjct: 266 GKQVHCFLLILAILMMAYTSMTFPVLCPYTEGF 298 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,410,231 Number of Sequences: 59808 Number of extensions: 253179 Number of successful extensions: 412 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 390 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 412 length of database: 16,821,457 effective HSP length: 76 effective length of database: 12,276,049 effective search space used: 932979724 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -