BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30509 (460 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BT021362-1|AAX33510.1| 1313|Drosophila melanogaster LP14331p pro... 35 0.060 AE013599-1857|AAF58271.3| 1313|Drosophila melanogaster CG8523-PA... 35 0.060 L07065-1|AAA16186.1| 1283|Drosophila melanogaster P-glycoprotein... 34 0.080 >BT021362-1|AAX33510.1| 1313|Drosophila melanogaster LP14331p protein. Length = 1313 Score = 34.7 bits (76), Expect = 0.060 Identities = 23/79 (29%), Positives = 39/79 (49%) Frame = +2 Query: 92 GCIAALAKSWCYNFMHYLLPQYGTWXVKHVGHLMDQLFIVAC*RRPTSGLLTKALAFSSH 271 G + LA+S + F + YGTW V H G L +F V+ + + ALAF+ + Sbjct: 974 GLVYGLARSLMF-FAYAACMYYGTWCVIHRGILFGDVFKVSQALIMGTASIANALAFAPN 1032 Query: 272 AILQNGFNETVTLYDLVRK 328 +Q G + T++ +R+ Sbjct: 1033 --MQKGVSAAKTIFTFLRR 1049 >AE013599-1857|AAF58271.3| 1313|Drosophila melanogaster CG8523-PA protein. Length = 1313 Score = 34.7 bits (76), Expect = 0.060 Identities = 23/79 (29%), Positives = 39/79 (49%) Frame = +2 Query: 92 GCIAALAKSWCYNFMHYLLPQYGTWXVKHVGHLMDQLFIVAC*RRPTSGLLTKALAFSSH 271 G + LA+S + F + YGTW V H G L +F V+ + + ALAF+ + Sbjct: 974 GLVYGLARSLMF-FAYAACMYYGTWCVIHRGILFGDVFKVSQALIMGTASIANALAFAPN 1032 Query: 272 AILQNGFNETVTLYDLVRK 328 +Q G + T++ +R+ Sbjct: 1033 --MQKGVSAAKTIFTFLRR 1049 >L07065-1|AAA16186.1| 1283|Drosophila melanogaster P-glycoprotein/multidrug resistanceprotein protein. Length = 1283 Score = 34.3 bits (75), Expect = 0.080 Identities = 23/79 (29%), Positives = 39/79 (49%) Frame = +2 Query: 92 GCIAALAKSWCYNFMHYLLPQYGTWXVKHVGHLMDQLFIVAC*RRPTSGLLTKALAFSSH 271 G + LA+S + F + YGTW V H G L +F V+ + + ALAF+ + Sbjct: 944 GLVYGLARSLMF-FAYAACMYYGTWCVIHRGILFGDVFKVSQAVIMGTASIANALAFAPN 1002 Query: 272 AILQNGFNETVTLYDLVRK 328 +Q G + T++ +R+ Sbjct: 1003 --MQKGVSAAKTIFTFLRR 1019 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,799,563 Number of Sequences: 53049 Number of extensions: 357660 Number of successful extensions: 802 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 800 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 802 length of database: 24,988,368 effective HSP length: 79 effective length of database: 20,797,497 effective search space used: 1518217281 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -