BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30502 (671 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY239359-1|AAO73809.1| 2259|Anopheles gambiae dicer-1 protein. 25 2.9 DQ370037-1|ABD18598.1| 121|Anopheles gambiae putative TIL domai... 23 6.6 AF203338-1|AAF19833.1| 113|Anopheles gambiae immune-responsive ... 23 6.6 U03849-2|AAA53489.1| 1049|Anopheles gambiae putative reverse tra... 23 8.8 M93689-2|AAA29367.1| 975|Anopheles gambiae protein ( Anopheles ... 23 8.8 >AY239359-1|AAO73809.1| 2259|Anopheles gambiae dicer-1 protein. Length = 2259 Score = 24.6 bits (51), Expect = 2.9 Identities = 14/34 (41%), Positives = 18/34 (52%) Frame = +1 Query: 499 RVHNKKVRTFPLCFDDTDMTAMLENASQKQVLVP 600 R N+K P ++T A EN QKQ+LVP Sbjct: 1099 RYVNRKGVALPTSSEETKR-AKRENLEQKQILVP 1131 >DQ370037-1|ABD18598.1| 121|Anopheles gambiae putative TIL domain polypeptide protein. Length = 121 Score = 23.4 bits (48), Expect = 6.6 Identities = 8/16 (50%), Positives = 9/16 (56%) Frame = -2 Query: 439 LAAMMECVASCFCSHG 392 LA CV CFC +G Sbjct: 86 LACTKHCVEGCFCRNG 101 >AF203338-1|AAF19833.1| 113|Anopheles gambiae immune-responsive trypsin-like serineprotease-related protein ISPR10 protein. Length = 113 Score = 23.4 bits (48), Expect = 6.6 Identities = 9/20 (45%), Positives = 14/20 (70%) Frame = -2 Query: 325 QLLTPSTVKLNWTAHEDQDR 266 Q + STV+L W+A +DQ + Sbjct: 11 QNIRSSTVRLIWSAQDDQQQ 30 >U03849-2|AAA53489.1| 1049|Anopheles gambiae putative reverse transcriptase protein. Length = 1049 Score = 23.0 bits (47), Expect = 8.8 Identities = 12/26 (46%), Positives = 14/26 (53%) Frame = +3 Query: 213 WHVPAYPHQ*RT*AIN*QRSWSSCAV 290 W VP Y RT AIN + S CA+ Sbjct: 601 WMVPIYKKGDRTDAINYRGITSLCAI 626 >M93689-2|AAA29367.1| 975|Anopheles gambiae protein ( Anopheles gambiae T1 retroposon. ). Length = 975 Score = 23.0 bits (47), Expect = 8.8 Identities = 12/42 (28%), Positives = 19/42 (45%) Frame = -1 Query: 431 HDGVCGFLLLLSRGVANSWLTDTALYLSSFPSIMSSTSDAFN 306 H C ++ RG+ + T L FP+I+ S S A + Sbjct: 535 HKKGCRSIVSNYRGITQTCATAKTFELCIFPTILHSCSSAIS 576 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 744,792 Number of Sequences: 2352 Number of extensions: 15626 Number of successful extensions: 30 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 30 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 30 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 67322955 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -