BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30491 (662 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 08_01_0987 + 9979651-9979746,9979818-9980058,9980947-9981090,998... 29 3.3 >08_01_0987 + 9979651-9979746,9979818-9980058,9980947-9981090, 9981253-9981313,9981603-9982061,9982472-9982529, 9983579-9983839 Length = 439 Score = 29.1 bits (62), Expect = 3.3 Identities = 16/51 (31%), Positives = 27/51 (52%), Gaps = 2/51 (3%) Frame = +1 Query: 64 CNEVATENRG--FAEIKKSDKYHV*FVITVPLSYETRPRERLNEIAAILCF 210 C+E T G F +I+ +K++ +V TV S +++LNE+ CF Sbjct: 40 CDEEITPAVGMKFEDIEAVEKFYKSYVHTVGFSVRIGQQKKLNEVVQCKCF 90 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,864,314 Number of Sequences: 37544 Number of extensions: 234636 Number of successful extensions: 326 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 323 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 326 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1667659452 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -