BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30491 (662 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamat... 24 1.5 AB201717-1|BAD90662.1| 107|Apis mellifera apime-corazonin prepr... 21 7.9 >AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamate receptor protein. Length = 1040 Score = 23.8 bits (49), Expect = 1.5 Identities = 8/22 (36%), Positives = 15/22 (68%) Frame = +1 Query: 1 NNITL*CLLSFSFILAPNDVIC 66 + I L L++F+ +L P D++C Sbjct: 700 SGILLCYLVTFALVLRPTDIVC 721 >AB201717-1|BAD90662.1| 107|Apis mellifera apime-corazonin preprohormone protein. Length = 107 Score = 21.4 bits (43), Expect = 7.9 Identities = 11/32 (34%), Positives = 14/32 (43%) Frame = -3 Query: 129 NMILITFFYFRKTSILCCNFITYDVIWG*NKR 34 + ILI F +I+ C TY W KR Sbjct: 4 SQILILFILSLTITIVMCQTFTYSHGWTNGKR 35 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 160,846 Number of Sequences: 438 Number of extensions: 3276 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 19977660 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -