BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30491 (662 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g17930.1 68415.m02076 FAT domain-containing protein / phospha... 29 2.1 At4g36080.1 68417.m05136 FAT domain-containing protein / phospha... 29 2.8 At4g39550.1 68417.m05592 kelch repeat-containing F-box family pr... 29 3.6 >At2g17930.1 68415.m02076 FAT domain-containing protein / phosphatidylinositol 3- and 4-kinase family protein contains Pfam profiles PF02259 FAT domain, PF00454 Phosphatidylinositol 3- and 4-kinase, PF02260: FATC domain Length = 3795 Score = 29.5 bits (63), Expect = 2.1 Identities = 16/52 (30%), Positives = 31/52 (59%) Frame = +2 Query: 86 IEVLRK*KKVISIMFNLL*LCHCHMKPGLVKD*TKLQLFYVLEISERYP*NI 241 + LR K ++++F++L + H + D T L+ FY++E++E YP N+ Sbjct: 1623 LNYLRHEKSEVNVLFDILSIFLFHSRI----DYTFLKEFYIIEVAEGYPPNM 1670 >At4g36080.1 68417.m05136 FAT domain-containing protein / phosphatidylinositol 3- and 4-kinase family protein contains Pfam profiles PF00454: Phosphatidylinositol 3- and 4-kinase, PF02259: FAT domain, PF02260: FATC domain Length = 3839 Score = 29.1 bits (62), Expect = 2.8 Identities = 16/52 (30%), Positives = 31/52 (59%) Frame = +2 Query: 86 IEVLRK*KKVISIMFNLL*LCHCHMKPGLVKD*TKLQLFYVLEISERYP*NI 241 + LR K ++++F++L + H + D T L+ FY++E++E YP N+ Sbjct: 1679 LNYLRHEKSEMNVLFDVLLIFLFHSRI----DYTFLREFYIIEVAEEYPPNM 1726 >At4g39550.1 68417.m05592 kelch repeat-containing F-box family protein similar to SKP1 interacting partner 6 [Arabidopsis thaliana] GI:10716957; contains Pfam profiles PF01344: Kelch motif, PF00646: F-box domain Length = 392 Score = 28.7 bits (61), Expect = 3.6 Identities = 15/35 (42%), Positives = 21/35 (60%) Frame = +1 Query: 58 VICNEVATENRGFAEIKKSDKYHV*FVITVPLSYE 162 ++C +A E R EI ++H V+TVPLSYE Sbjct: 350 ILCAVIALERRNSEEIWGKVEWHD-AVLTVPLSYE 383 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,905,169 Number of Sequences: 28952 Number of extensions: 213683 Number of successful extensions: 360 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 352 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 360 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1393347168 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -