BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30485 (380 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q4X6Z3 Cluster: Putative uncharacterized protein; n=1; ... 31 5.5 UniRef50_Q236B6 Cluster: Putative uncharacterized protein; n=1; ... 31 5.5 UniRef50_A4G6F0 Cluster: Putative MSHA biogenesis protein MshN,;... 31 9.6 UniRef50_A7RM19 Cluster: Predicted protein; n=3; Nematostella ve... 31 9.6 >UniRef50_Q4X6Z3 Cluster: Putative uncharacterized protein; n=1; Plasmodium chabaudi|Rep: Putative uncharacterized protein - Plasmodium chabaudi Length = 120 Score = 31.5 bits (68), Expect = 5.5 Identities = 15/39 (38%), Positives = 21/39 (53%) Frame = -3 Query: 192 FTGGAFKRKKLIKSLLLQIYLWFFFLCN*LIYSCFEPHQ 76 F GG FK+KK L + +FFF N + + F PH+ Sbjct: 53 FFGGVFKKKK--NFLFFFFFFFFFFFHNNIFFYFFPPHK 89 >UniRef50_Q236B6 Cluster: Putative uncharacterized protein; n=1; Tetrahymena thermophila SB210|Rep: Putative uncharacterized protein - Tetrahymena thermophila SB210 Length = 369 Score = 31.5 bits (68), Expect = 5.5 Identities = 15/39 (38%), Positives = 18/39 (46%) Frame = +2 Query: 143 NNKDFINFFRLNAPPVNLRIWS*RSAHWRHRFVTHVGEP 259 NNKDF F + PPV + HW RF+ EP Sbjct: 19 NNKDFQKFLKELQPPVPEQAMEMIKRHWYKRFINQQFEP 57 >UniRef50_A4G6F0 Cluster: Putative MSHA biogenesis protein MshN,; n=1; Herminiimonas arsenicoxydans|Rep: Putative MSHA biogenesis protein MshN, - Herminiimonas arsenicoxydans Length = 397 Score = 30.7 bits (66), Expect = 9.6 Identities = 13/30 (43%), Positives = 21/30 (70%) Frame = +3 Query: 204 GVSVVLIGGIDLLHMWVNLSPPTQLIVATI 293 G+S +L+GG+ LL +W+ +PP Q A+I Sbjct: 45 GISTLLLGGV-LLWLWLRPAPPAQTAPASI 73 >UniRef50_A7RM19 Cluster: Predicted protein; n=3; Nematostella vectensis|Rep: Predicted protein - Nematostella vectensis Length = 908 Score = 30.7 bits (66), Expect = 9.6 Identities = 10/22 (45%), Positives = 15/22 (68%) Frame = -1 Query: 149 YYCRYIYGFFFCVTS*FTLASN 84 +YC Y+ F+CV S FT+ +N Sbjct: 569 FYCEYLSAIFYCVLSPFTVGAN 590 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 345,649,264 Number of Sequences: 1657284 Number of extensions: 5988399 Number of successful extensions: 10224 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 10056 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10222 length of database: 575,637,011 effective HSP length: 91 effective length of database: 424,824,167 effective search space used: 14868845845 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -