BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30480 (737 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC31H12.07 |sec231|sec23a, SPCC5E4.01|GTPase activating protei... 26 6.4 SPAC13C5.03 |tht1||nuclear membrane protein involved in karyogam... 25 8.5 >SPCC31H12.07 |sec231|sec23a, SPCC5E4.01|GTPase activating protein Sec23a|Schizosaccharomyces pombe|chr 3|||Manual Length = 759 Score = 25.8 bits (54), Expect = 6.4 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = +2 Query: 143 PHAHMHTRTLLWITDFCV 196 P+ H+ TR WI FC+ Sbjct: 66 PYCHIDTRAKFWICPFCL 83 >SPAC13C5.03 |tht1||nuclear membrane protein involved in karyogamy |Schizosaccharomyces pombe|chr 1|||Manual Length = 543 Score = 25.4 bits (53), Expect = 8.5 Identities = 17/45 (37%), Positives = 27/45 (60%), Gaps = 2/45 (4%) Frame = -3 Query: 354 PILIAVIRNLNAKFCGEQITKLILSSFAYIGFSLWNIYT--FFQV 226 P++ V + +N F G I+SSFA+IGF+L+ + FF+V Sbjct: 352 PLIDIVEKFMNVYFKG---LSNIISSFAFIGFTLFATLSSLFFKV 393 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,020,103 Number of Sequences: 5004 Number of extensions: 63194 Number of successful extensions: 165 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 159 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 165 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 349251756 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -