BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30476 (826 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 08_02_0200 - 14179389-14180488,14180575-14180736,14180983-141813... 30 2.6 01_02_0116 - 11252220-11253313,11253398-11253559,11253977-112543... 30 2.6 11_04_0454 - 17895935-17896093,17896878-17896911,17897114-178972... 29 3.4 01_06_0996 + 33667663-33667900,33668019-33668091,33668785-336688... 29 3.4 01_06_0995 + 33661367-33661380,33661729-33661826,33662059-336622... 29 3.4 01_06_0994 + 33653055-33653144,33653219-33653310,33653483-336535... 29 3.4 06_01_0580 + 4148969-4149101,4149394-4149546,4149682-4150095,415... 29 4.5 07_01_1203 - 11464142-11464324,11464422-11464484,11464685-114665... 29 5.9 01_06_0998 + 33685051-33685143,33685231-33685322,33685490-336855... 29 5.9 01_05_0799 + 25334460-25334994,25335060-25335236,25335325-253354... 28 7.8 >08_02_0200 - 14179389-14180488,14180575-14180736,14180983-14181383, 14182078-14182272,14182980-14183094,14183180-14183428, 14184032-14184093,14184335-14184435,14184701-14184815, 14185211-14185302,14187619-14187777 Length = 916 Score = 29.9 bits (64), Expect = 2.6 Identities = 11/23 (47%), Positives = 14/23 (60%) Frame = -2 Query: 201 LKGSGSW*EQYQRTVGTIDSRWV 133 +KG W +YQR GTID W+ Sbjct: 701 VKGLDEWPNEYQRQYGTIDLYWI 723 >01_02_0116 - 11252220-11253313,11253398-11253559,11253977-11254306, 11254328-11254377,11255195-11255389,11255532-11255625, 11255713-11255961,11256831-11256892,11257434-11257534, 11257766-11257880,11258384-11258475,11259197-11259333, 11259721-11259760 Length = 906 Score = 29.9 bits (64), Expect = 2.6 Identities = 11/23 (47%), Positives = 14/23 (60%) Frame = -2 Query: 201 LKGSGSW*EQYQRTVGTIDSRWV 133 +KG W +YQR GTID W+ Sbjct: 693 VKGLDEWPNEYQRQYGTIDLYWI 715 >11_04_0454 - 17895935-17896093,17896878-17896911,17897114-17897252, 17897487-17897561,17897666-17897945 Length = 228 Score = 29.5 bits (63), Expect = 3.4 Identities = 12/22 (54%), Positives = 15/22 (68%) Frame = -2 Query: 663 RRQGHPSQYCRSRGHQPGPNRR 598 RR+ H ++ R RG QP PNRR Sbjct: 27 RRRRHHQRHRRRRGGQPAPNRR 48 >01_06_0996 + 33667663-33667900,33668019-33668091,33668785-33668841, 33668970-33669067,33669482-33669637,33669744-33670366, 33670484-33670560,33671551-33671805,33671950-33672067, 33672174-33672345,33672434-33672975 Length = 802 Score = 29.5 bits (63), Expect = 3.4 Identities = 9/19 (47%), Positives = 13/19 (68%) Frame = -2 Query: 156 GTIDSRWVGILQFGPGWGA 100 G + +RW G+ Q G GWG+ Sbjct: 222 GPVPARWKGVCQVGEGWGS 240 >01_06_0995 + 33661367-33661380,33661729-33661826,33662059-33662214, 33663307-33663926,33664020-33664090,33664176-33664427, 33664494-33664611,33664715-33664886,33664970-33665511 Length = 680 Score = 29.5 bits (63), Expect = 3.4 Identities = 9/19 (47%), Positives = 13/19 (68%) Frame = -2 Query: 156 GTIDSRWVGILQFGPGWGA 100 G + +RW G+ Q G GWG+ Sbjct: 104 GPVPARWKGVCQVGEGWGS 122 >01_06_0994 + 33653055-33653144,33653219-33653310,33653483-33653580, 33653758-33653913,33654009-33654628,33654721-33654794, 33654905-33655156,33655250-33655367,33655468-33655639, 33655729-33656270 Length = 737 Score = 29.5 bits (63), Expect = 3.4 Identities = 9/19 (47%), Positives = 13/19 (68%) Frame = -2 Query: 156 GTIDSRWVGILQFGPGWGA 100 G + +RW G+ Q G GWG+ Sbjct: 160 GPVPARWKGVCQVGEGWGS 178 >06_01_0580 + 4148969-4149101,4149394-4149546,4149682-4150095, 4150218-4150294,4151479-4152699,4153057-4153128 Length = 689 Score = 29.1 bits (62), Expect = 4.5 Identities = 15/40 (37%), Positives = 22/40 (55%) Frame = -1 Query: 541 SLLVTMSSSLWRLPSDTLPP*TVVPHPSRSTKIPWGITTP 422 SL T+SS+L R+PS +LPP ++ +P I P Sbjct: 394 SLTNTLSSTLQRVPSSSLPPQELLECKQAKVSMPPSIRIP 433 >07_01_1203 - 11464142-11464324,11464422-11464484,11464685-11466515, 11467240-11468036 Length = 957 Score = 28.7 bits (61), Expect = 5.9 Identities = 15/53 (28%), Positives = 28/53 (52%) Frame = -3 Query: 764 DPFSERTDAGEYYGVDVIGIALSKRYDAY*RILKEGRGTQVSIVVVAATSPDQ 606 D S+R +G D IG ++ +A ++LK+ G +SI+ +A+ D+ Sbjct: 320 DDNSKRLFNRRIFGADCIGTTNNQSIEAMEKVLKKCGGVPLSIITIASLLVDK 372 >01_06_0998 + 33685051-33685143,33685231-33685322,33685490-33685587, 33686671-33686826,33686927-33687546,33687888-33687958, 33688072-33688326,33688426-33688543,33688671-33688842, 33688928-33689469 Length = 738 Score = 28.7 bits (61), Expect = 5.9 Identities = 10/18 (55%), Positives = 11/18 (61%) Frame = -2 Query: 156 GTIDSRWVGILQFGPGWG 103 G I SRW G+ Q G WG Sbjct: 161 GPIPSRWKGVCQLGQAWG 178 >01_05_0799 + 25334460-25334994,25335060-25335236,25335325-25335447, 25335559-25335624,25335717-25336685,25336791-25336912, 25337156-25337549,25337888-25338009,25338253-25338646, 25338983-25339104,25339348-25339830,25340291-25340960, 25341713-25342224,25342484-25342540 Length = 1581 Score = 28.3 bits (60), Expect = 7.8 Identities = 18/63 (28%), Positives = 34/63 (53%), Gaps = 2/63 (3%) Frame = -3 Query: 725 GVDVIGIALSKRYDAY*RILKEGRGTQVSIVVVAATSPDQTGAEFVISHDAIMTLV--LF 552 G D+ L + D Y +L+ G GT+ +IV PD+ ++ + D++ TL+ +F Sbjct: 1378 GKDISDYGLPELTDTY-YLLRIGNGTKNTIVDDYVRLPDEIVIGYLDNEDSVNTLIEYVF 1436 Query: 551 PAV 543 P++ Sbjct: 1437 PSL 1439 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 23,850,208 Number of Sequences: 37544 Number of extensions: 569850 Number of successful extensions: 1519 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 1465 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1518 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2268190812 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -