BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30475 (737 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ869051-1|ABJ09598.1| 581|Apis mellifera pyrokinin-like recept... 23 3.0 DQ257631-1|ABB82366.1| 424|Apis mellifera yellow e3-like protei... 21 9.1 >DQ869051-1|ABJ09598.1| 581|Apis mellifera pyrokinin-like receptor 2 protein. Length = 581 Score = 23.0 bits (47), Expect = 3.0 Identities = 10/36 (27%), Positives = 21/36 (58%) Frame = +2 Query: 617 NTYHLGFILMMVYTINALSVLKILIIVEKRYNRMIS 724 + + + +L V + + VL ILI ++ R +RM++ Sbjct: 220 HAFEISTMLFFVLPMTIIIVLYILIAIKLRRSRMLT 255 >DQ257631-1|ABB82366.1| 424|Apis mellifera yellow e3-like protein protein. Length = 424 Score = 21.4 bits (43), Expect = 9.1 Identities = 8/27 (29%), Positives = 14/27 (51%) Frame = +1 Query: 454 VKEADVLKHRGQVMSTMQKKDHNQLWL 534 VK+ + L+ + KKD +LW+ Sbjct: 350 VKDPETLQFPSGMKIISSKKDRQELWI 376 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 210,242 Number of Sequences: 438 Number of extensions: 4553 Number of successful extensions: 7 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 23023035 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -