BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30470 (736 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ298318-1|CAC83675.1| 1349|Homo sapiens mucin 5 protein. 30 7.5 BC001731-1|AAH01731.2| 709|Homo sapiens cell cycle associated p... 30 9.9 >AJ298318-1|CAC83675.1| 1349|Homo sapiens mucin 5 protein. Length = 1349 Score = 30.3 bits (65), Expect = 7.5 Identities = 18/57 (31%), Positives = 30/57 (52%) Frame = -2 Query: 474 TAALISGSVTSIARVP*KTTEASLITALISALVTTIVTSKTALITLTRITETGVAVT 304 T + S TSI+ P +T ++ ++ ISA T+I+++ T T + T T A T Sbjct: 371 TTSTTSTPQTSISSAPTSSTTSAPTSSTISARTTSIISAPTTSTTSSPTTSTTSATT 427 >BC001731-1|AAH01731.2| 709|Homo sapiens cell cycle associated protein 1 protein. Length = 709 Score = 29.9 bits (64), Expect = 9.9 Identities = 17/45 (37%), Positives = 23/45 (51%), Gaps = 8/45 (17%) Frame = +1 Query: 487 GYRSGYNQYRSSFDRYPAT-------NAGNFFGGY-GDGYSDNFR 597 G+R GY+ YR SF P + +A + GY DGY NF+ Sbjct: 631 GFRGGYDGYRPSFSNTPNSGYTQSQFSAPRDYSGYQRDGYQQNFK 675 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 66,830,690 Number of Sequences: 237096 Number of extensions: 1083464 Number of successful extensions: 3262 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3063 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3258 length of database: 76,859,062 effective HSP length: 88 effective length of database: 55,994,614 effective search space used: 8735159784 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -