BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30468 (519 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g01690.2 68415.m00097 expressed protein 28 3.3 At2g01690.1 68415.m00096 expressed protein 28 3.3 >At2g01690.2 68415.m00097 expressed protein Length = 744 Score = 28.3 bits (60), Expect = 3.3 Identities = 14/38 (36%), Positives = 24/38 (63%), Gaps = 1/38 (2%) Frame = +3 Query: 300 KIRIIARVNHQPLRSAMEQPHPG-GTACMITVSLRQVS 410 KIR++AR ++ LRS +P G +++V+ RQ+S Sbjct: 312 KIRVVARETNEELRSIHVEPSDGFDVGAILSVARRQLS 349 >At2g01690.1 68415.m00096 expressed protein Length = 743 Score = 28.3 bits (60), Expect = 3.3 Identities = 14/38 (36%), Positives = 24/38 (63%), Gaps = 1/38 (2%) Frame = +3 Query: 300 KIRIIARVNHQPLRSAMEQPHPG-GTACMITVSLRQVS 410 KIR++AR ++ LRS +P G +++V+ RQ+S Sbjct: 311 KIRVVARETNEELRSIHVEPSDGFDVGAILSVARRQLS 348 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,983,527 Number of Sequences: 28952 Number of extensions: 244532 Number of successful extensions: 506 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 503 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 506 length of database: 12,070,560 effective HSP length: 76 effective length of database: 9,870,208 effective search space used: 947539968 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -